Details for Lyrate rockcress Locus 16037270

Position : sca3 ( 5`- 6334018 .. 6332218 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16037270

Protein [Map View]
MASASSSDGVAGRIQNASLVLVSDNSSTLADIRKAVAMMKNIAVQLEKENQTDKVKDLENSVAELLDLYSDCNHRSSAIQ
SVANGYQPGEQLTDFKKLLDDEFTKLKATPSVPQNEHLMRQFREAVWNVHHAGEPMPGDDEEDIVMTSTQCPLLNMTCPL
SGKPVTELADPVRSMDCRHVYEKAVILHYIVNNPNGNCPVAGCRGKLQNSKVICDAMLKFEIEEMRSLNKQSNRAEVIED
FTEDLDED*

DNA
ATGGCGTCGGCGTCCTCGTCTGACGGAGTTGCCGGAAGGATTCAGAACGCTTCGTTGGTTCTTGTGTCCGATAACAGTTC
CACGCTTGCTGATATCCGAAAAGCTGTGGCAATGATGAAGAACATTGCTGTTCAATTGGAGAAAGAAAATCAAACTGACA
AGGTTAAGGATCTTGAAAATTCTGTGGCTGAGCTATTGGATTTGTATAGTGATTGTAATCACCGTTCGTCAGCAATTCAA
TCCGTGGCAAATGGGTACCAACCCGGGGAACAGTTAACGGACTTTAAAAAGTTGCTTGATGATGAATTCACAAAACTCAA
GGCTACACCTTCTGTGCCGCAAAATGAGCATTTGATGCGCCAGTTCAGGGAAGCAGTTTGGAACGTTCATCATGCAGGTG
AACCAATGCCTGGTGACGATGAAGAGGACATTGTCATGACCAGTACTCAGTGCCCTCTACTAAACATGACGTGTCCCTTG
AGCGGGAAGCCTGTCACTGAACTAGCAGATCCAGTTCGCAGTATGGATTGCAGGCACGTCTATGAAAAAGCTGTAATCCT
GCATTACATAGTCAACAATCCAAATGGGAATTGTCCTGTAGCAGGATGCCGAGGTAAACTGCAGAACAGCAAAGTGATTT
GTGATGCAATGTTGAAGTTTGAAATCGAGGAGATGCGCTCGTTGAACAAACAATCTAATAGGGCTGAAGTGATTGAAGAC
TTCACAGAAGATCTCGACGAAGATTAG