Details for Lyrate rockcress Locus 16037246

Position : sca5 ( 5`- 17840154 .. 17841931 -3` )
Annotation : [B2G] can [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16037246

Protein [Map View]
MGNALRLLRKCLNPHGVSASSAGVSALSRDLLNFETTSQVPEKLGSYVVSSQKAQANWYRKILEAWKQAKPRPKTPEEAS
RLVVATLKNHLKADVEGLLSFYGLPSPHNLVEVPTESPVSLPKGVRFELKTLPVDTKSVADGDTVTVYVSSKDPLVSSSL
PKEVSLAAVKRAKAREKKNYTEADALHKTIIASGYRMISFQNEEVLAKKFRIRLSGIDSPESKMPYGKEAHDELLKMVEG
KCLKVLVYTEDRYGRCVGDIYCNGKFVQEVMLKKGLAWHYVAYDKRAELAKWENEARQKRIGLWVSSNPEKPWEWRKNKR
EGT*

DNA
ATGGGTAACGCGCTTAGGTTACTCCGGAAATGCTTGAATCCTCACGGCGTCTCCGCCTCTTCCGCCGGCGTCTCAGCTCT
TTCTCGTGATCTCTTAAACTTTGAGACCACTTCTCAGGTTCCTGAAAAGCTTGGGAGTTACGTTGTGTCTTCCCAAAAGG
CTCAAGCAAACTGGTATAGAAAAATACTTGAGGCATGGAAGCAAGCTAAGCCTCGGCCTAAAACTCCTGAGGAAGCCTCT
AGGCTTGTTGTCGCGACTCTAAAGAACCATCTAAAAGCAGATGTTGAGGGACTTTTGTCTTTCTATGGACTGCCTTCACC
TCACAATCTCGTTGAGGTCCCTACGGAATCTCCTGTGTCTTTACCTAAAGGAGTTCGGTTTGAGCTTAAAACGCTTCCGG
TGGATACAAAATCTGTAGCAGATGGAGATACCGTTACTGTATATGTTAGTAGCAAAGACCCGCTTGTGTCATCTTCTCTT
CCTAAGGAAGTGAGTCTTGCAGCGGTTAAAAGAGCCAAAGCGCGTGAGAAGAAGAATTATACTGAAGCAGATGCACTTCA
CAAGACTATCATAGCTTCTGGTTACAGGATGATAAGTTTTCAGAATGAAGAAGTGCTTGCTAAAAAGTTCAGAATTAGAC
TAAGCGGAATAGATTCACCGGAGAGCAAAATGCCGTATGGAAAAGAGGCGCACGATGAGCTACTCAAGATGGTTGAAGGG
AAATGCTTGAAGGTGTTAGTATATACAGAGGATCGTTATGGAAGATGTGTAGGAGATATATACTGCAATGGAAAATTTGT
ACAAGAAGTAATGCTAAAGAAAGGTCTTGCTTGGCATTATGTAGCCTACGACAAGCGTGCAGAGCTCGCAAAGTGGGAAA
ATGAGGCTAGGCAAAAGCGTATTGGCTTGTGGGTATCTTCTAATCCAGAGAAGCCATGGGAGTGGAGAAAGAACAAACGT
GAAGGCACTTAA