Details for Lyrate rockcress Locus 16037233

Position : sca3 ( 5`- 6892338 .. 6893962 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_479087 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16037233

Protein [Map View]
MTRRCSHCSNNGHNSRTCPTRGGGTCGGSGGGGGGSCSSSTVKLFGVRLTDGSIIKKSASMGNLSALAVAAAAATHHRLS
PSSPLATSNLNDSPLSDHARYSNLHHNEGYLSDDPAHGSGSSHRRGERKRGVPWTEEEHRLFLVGLQKLGKGDWRGISRN
YVTSRTPTQVASHAQKYFIRHTSSSRRKRRSSLFDMVTDEMVTDSSPTEDQSHQTLNRFSPSKEPENKIYLPSLELSLNN
TTESEVVVATAPPQEKTEETIEPSNGVSPMVVPGGFFPPCFPITYTIWLPATSTSLHGTEHALEAETSSQQHQVLKPKPG
FAKERVNMDELVGMSQLSIGMATRHESETSPSPLSLKLEPSRPSAFHSNGSVTGADLSKGNSAIQAI*

DNA
ATGACTCGTCGGTGTTCGCATTGTAGTAACAATGGGCACAATTCACGCACGTGTCCAACGCGTGGTGGTGGCACGTGCGG
TGGAAGTGGCGGAGGTGGTGGAGGTTCTTGTTCCTCCTCCACCGTGAAGTTATTCGGCGTAAGGTTAACGGATGGGTCGA
TTATTAAAAAGAGTGCGAGTATGGGTAATCTCTCGGCATTGGCTGTTGCGGCGGCGGCGGCGACGCACCACCGTTTATCT
CCGTCGTCTCCTCTGGCGACGTCAAATCTTAATGATTCGCCGTTATCGGATCATGCCCGATACTCTAATTTGCATCATAA
CGAAGGGTATCTATCTGATGATCCTGCTCATGGTTCTGGGTCTAGTCACCGTCGTGGAGAGAGGAAGAGAGGTGTTCCTT
GGACTGAGGAGGAACACAGGCTATTCTTAGTAGGTCTTCAGAAACTCGGGAAAGGAGATTGGCGCGGTATTTCGAGAAAC
TATGTAACTTCAAGAACTCCTACACAAGTGGCTAGTCATGCTCAGAAGTATTTCATTCGCCATACTAGTTCCAGCCGCAG
GAAAAGACGGTCTAGCCTATTCGACATGGTTACCGATGAGATGGTTACCGATTCATCGCCAACGGAAGACCAGAGTCATC
AGACCTTAAACCGTTTCTCTCCAAGCAAGGAACCTGAAAACAAAATCTACCTTCCTTCACTTGAGCTCTCACTAAATAAT
ACCACGGAATCTGAAGTGGTCGTAGCCACGGCGCCACCACAGGAAAAAACTGAAGAAACTATAGAACCATCAAATGGGGT
TTCACCAATGGTAGTCCCGGGCGGCTTCTTTCCACCTTGTTTTCCAATCACTTACACAATTTGGCTACCTGCGACTTCCA
CTTCACTTCATGGTACAGAACATGCCTTAGAAGCTGAGACTTCTTCTCAGCAGCATCAGGTCCTAAAACCAAAACCTGGA
TTTGCTAAAGAACGTGTGAACATGGACGAGCTGGTCGGTATGTCTCAGCTTAGCATAGGAATGGCGACAAGACACGAAAG
TGAAACTTCCCCTTCCCCTCTATCTTTGAAACTAGAGCCCTCAAGGCCATCAGCGTTTCACTCAAACGGCTCGGTTACTG
GCGCAGATTTGAGTAAAGGCAACAGCGCGATTCAGGCGATCTGA