Details for Lyrate rockcress Locus 16037228

Position : sca3 ( 5`- 6776900 .. 6774928 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16037228

Protein [Map View]
MTGNADSGKIATEKDPRKIVFTKLELSPVFLESPVKEIPPFPPISREHSETKDTTDQEGITWRKRCRCKQSKCLKLYCDC
FASGVLCTDCDCVDCHNNSDNYDARDAAVVNVLGRNPNAFNEKLFSSINDKQCKAAPDTRPGLLSRGCKCKRTKCLKKYC
ECFQANVLCSDNCKCINCKNVSEAFQPSVFAWGLNSRKLYEGFDNPEKKFVCDLGIISPSEDSVGFNSHNTAGCMNYAPG
FSAHNSPQVYRRRRHQELPEWNSCPAPLFSIPDNSIQNALGSPMSSSPKLPYRKKKPPLGYASTVVPDLGDICSLLLAAS
ETATANAEDQNRICIKPDDKVDNVYTEVLSESESGNVEEEIQSFRRLIELIDAQYNGEEHSKCKTETSVHETDIYMEQER
AVLETFRDCLQTFIKSRLDSI*

DNA
ATGACAGGTAACGCAGATTCCGGTAAAATCGCGACAGAGAAAGACCCTAGGAAGATCGTTTTCACCAAATTGGAGTTATC
TCCCGTCTTCCTTGAGTCTCCTGTTAAAGAAATTCCTCCTTTTCCTCCGATTTCTCGAGAGCATTCAGAAACAAAGGATA
CGACAGATCAGGAAGGCATTACTTGGAGGAAACGATGTCGATGCAAACAATCCAAATGTCTAAAGTTGTACTGTGACTGT
TTTGCATCAGGAGTGTTATGTACCGACTGTGATTGTGTTGATTGTCATAACAACTCTGACAACTATGATGCCAGAGATGC
AGCTGTGGTGAATGTACTAGGTCGCAACCCAAATGCCTTCAATGAGAAACTTTTTAGCAGCATAAATGACAAGCAGTGTA
AGGCTGCACCTGATACTAGACCTGGACTGCTTTCGAGAGGCTGTAAATGCAAAAGAACCAAGTGCTTGAAGAAGTACTGT
GAATGCTTTCAGGCTAATGTTTTGTGCTCAGACAACTGTAAATGCATCAACTGCAAGAATGTTAGTGAAGCGTTCCAGCC
TTCTGTTTTTGCCTGGGGACTAAACAGTAGGAAGCTTTACGAAGGATTTGATAATCCAGAGAAGAAGTTTGTCTGTGATC
TAGGAATCATTTCTCCTAGCGAAGACAGTGTCGGCTTTAACAGCCACAATACTGCTGGTTGTATGAATTATGCTCCTGGA
TTTTCTGCTCACAATTCCCCACAGGTATACCGGAGAAGAAGACACCAAGAGCTACCTGAGTGGAATTCTTGTCCAGCTCC
ATTATTTTCGATACCTGACAATTCCATTCAAAATGCTCTGGGTTCCCCTATGTCTAGCTCTCCTAAGCTTCCTTACAGAA
AGAAAAAGCCCCCATTGGGATATGCTTCCACAGTTGTTCCAGATTTGGGAGATATATGCTCACTTCTCTTAGCAGCATCT
GAAACTGCTACAGCCAATGCAGAAGACCAGAACAGGATATGTATAAAGCCTGATGATAAGGTAGACAACGTGTACACTGA
GGTATTGAGTGAGTCTGAAAGCGGTAATGTGGAAGAAGAAATACAGTCCTTTCGAAGATTGATCGAACTGATAGATGCTC
AATACAATGGAGAAGAGCATTCCAAATGTAAGACCGAGACAAGTGTCCATGAAACAGATATATACATGGAGCAGGAAAGG
GCAGTGCTTGAAACTTTCAGAGACTGTCTCCAAACGTTCATCAAATCGAGACTGGATTCTATTTAA