Details for Lyrate rockcress Locus 16037189

Position : sca3 ( 5`- 2130263 .. 2135168 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_477854 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16037189

Protein [Map View]
MSTDKLLLPNGVKSDGVMRRTRPDAAAAAAASYSLGGGSQIFDELPKAAIVSVSRPDTTDFSPLLLSYTLELQYKQFKWT
LQKKASQVLYLHFALKKRLIIEDLHDKQEQVREWLHSLGIFDMQGSVVQDDEEPDDGALPLHYTEDSIKNRNVPSRAAFP
IIRPTIGRSETVVDRGRTAMQGYLSLFLGNLDIVNSKEVCKFLEVSRLSFAREYGSKMKEGFVTVKHLREVPGSDSVRCC
LPSHCFGFFGTSWTKVWAVLKPGFLALLEDPFSGKLLDIMVFDTLGLQSTKESSEQLRLAEQVKEQNPLRFGFKITSGDR
TVTLRTTSSRKVKEWVKAVDEAGCYSPHRFGSFAPPRGLTSDGSQAQWFVDGHTAFEAIAFAIQNATSEIFMTGWWLCPE
LYLKRPFEDHPSLRLDALLETKAKQGVKIYILLYKEVQIALKINSMYSKKRLQNIHKNVKVLRYPDHLSSGIYLWSHHDK
IVIVDYQVCFIGGLDLCFGRYDTAEHKIGDFPPYIWPGKDYYNPRESEPNSWEETMKDELDRRKYPRMPWHEVHCALWGP
PCRDVARHFVQRWNHSKRNKAPNEQTIPLLMPHHHMVLPHYLGTREIDIIAAAKPEEDPDKPVVLARQDSFSSASPPQDI
PLLLPQETDADFTSRGDLKFDSGSRQDLDRSGSQVEFPGETSEESDRDEAVNDWWWQIGKQSDCRCQIIRSVSQWSAGTS
QSEDSIHRAYCSLIQNAEHFIYIENQFFISGLEKDDTILNRVLETLYRRILKAHEQNKCFRVVIVIPLLPGFQGGIDDFG
AATVRALMHWQYRTISRERTSILDNLNALLGPKTQEYISFYGLRSYGRLFEDGPIATSQIYVHSKLMIVDDRIAVIGSSN
INDRSLLGSRDSEIGVVIEDKEFVESSMNGVKWMAGKFSYSLRCSLWSEHLGLHPGEMQKIEDPIKDATYKDLWMATAKK
NTDIYDQVFSCIPNEHIRSRAALRHNMSICKDKLGHTTIDLGIAPERLDSCGSDSWEMLKETRGHLVCFPLQFMCDQEDL
RPVFNESEFYTAPQVFH*

DNA
ATGTCGACGGATAAATTGCTACTTCCTAACGGCGTTAAGTCAGACGGAGTCATGAGAAGGACCAGACCTGATGCTGCGGC
GGCGGCGGCCGCTTCTTATTCTCTCGGCGGTGGAAGTCAAATATTTGACGAGCTCCCCAAGGCTGCGATCGTCTCGGTCT
CGAGACCCGACACCACCGATTTTAGTCCCTTGCTTCTTTCTTACACCTTGGAGCTTCAGTATAAACAGTTCAAGTGGACA
TTACAGAAGAAGGCTTCTCAAGTTCTTTACTTACATTTTGCGTTGAAGAAACGTTTGATCATTGAAGACCTTCACGACAA
GCAAGAACAGGTTAGAGAGTGGCTACACAGCTTGGGGATTTTTGATATGCAAGGATCAGTTGTGCAAGATGATGAAGAAC
CTGACGATGGCGCTCTTCCTCTGCACTATACTGAAGATAGTATCAAAAACAGGAATGTTCCTTCGCGTGCAGCGTTCCCA
ATCATTCGTCCAACTATAGGCCGGTCAGAGACAGTTGTAGACCGTGGGAGAACTGCAATGCAAGGCTACTTGAGTCTCTT
TCTAGGGAACTTGGACATTGTAAACTCTAAAGAGGTCTGCAAGTTCCTTGAAGTTTCTAGACTCTCGTTTGCTAGAGAGT
ACGGTTCCAAGATGAAAGAAGGATTTGTCACAGTGAAGCACCTGAGGGAAGTCCCGGGTTCTGATAGTGTCCGATGCTGT
CTTCCTTCACATTGTTTCGGCTTCTTTGGAACTAGCTGGACAAAGGTATGGGCGGTTCTGAAACCGGGATTCTTGGCGTT
ACTAGAAGATCCATTCAGCGGAAAGCTTCTAGATATAATGGTGTTTGACACATTGGGGTTACAGAGTACGAAAGAGTCTT
CTGAGCAACTGCGTTTGGCTGAACAGGTGAAGGAACAAAACCCATTGCGTTTTGGCTTTAAAATTACTAGTGGGGACCGA
ACCGTGACGCTGAGAACAACGAGCAGCAGGAAAGTTAAAGAGTGGGTTAAGGCCGTGGACGAAGCTGGTTGTTACAGTCC
ACATCGGTTTGGTTCGTTTGCACCACCTAGAGGCTTGACATCGGACGGAAGCCAGGCGCAGTGGTTCGTAGACGGTCACA
CTGCGTTCGAAGCCATCGCATTTGCAATTCAAAACGCAACATCAGAGATATTTATGACTGGTTGGTGGTTATGCCCGGAG
CTATATCTCAAACGCCCCTTTGAAGATCATCCGTCATTGCGGCTCGATGCGTTGCTGGAGACAAAAGCAAAACAGGGCGT
TAAGATTTATATTCTTTTGTATAAGGAAGTCCAAATCGCGCTGAAAATCAACAGTATGTACAGCAAGAAACGGCTTCAAA
ACATTCACAAGAACGTCAAAGTTCTTCGTTATCCAGACCATCTCTCCTCCGGCATATACCTCTGGTCGCACCACGATAAG
ATAGTGATTGTTGATTACCAAGTTTGCTTCATTGGAGGATTAGATCTCTGTTTTGGCCGCTACGATACAGCTGAACACAA
GATCGGAGATTTCCCTCCTTATATATGGCCAGGAAAGGATTATTACAATCCTAGAGAATCTGAACCAAACTCATGGGAAG
AAACGATGAAAGATGAGCTAGACAGGAGAAAGTACCCGAGAATGCCGTGGCACGAAGTCCACTGTGCTCTATGGGGACCG
CCTTGTCGCGATGTGGCTAGACATTTTGTCCAGAGGTGGAACCACTCTAAGAGAAACAAGGCACCTAATGAACAGACGAT
TCCGTTGCTGATGCCTCACCACCATATGGTTCTTCCTCACTACTTGGGAACTAGAGAGATCGATATTATCGCAGCGGCTA
AACCCGAGGAAGATCCTGACAAACCTGTTGTTCTTGCCAGACAAGACTCTTTCTCTTCTGCCTCGCCGCCACAGGACATC
CCTTTGCTTCTCCCACAAGAAACCGATGCAGATTTCACCAGCAGAGGAGATCTGAAGTTCGACAGCGGTTCAAGACAAGA
TCTTGATCGATCCGGCAGTCAAGTTGAGTTTCCTGGGGAAACTTCAGAGGAAAGCGACCGGGACGAGGCTGTGAACGACT
GGTGGTGGCAGATTGGGAAGCAAAGTGATTGCCGGTGTCAAATAATCAGAAGTGTTAGCCAATGGTCTGCTGGGACGAGC
CAGTCTGAAGATAGCATTCATAGAGCTTATTGTTCGCTTATCCAGAACGCTGAACATTTTATCTACATAGAGAACCAATT
CTTCATCTCCGGGCTAGAAAAAGATGACACGATTCTTAACCGCGTTCTTGAAACGTTATACAGACGCATTCTGAAGGCTC
ATGAACAGAACAAGTGCTTCCGCGTTGTGATCGTTATTCCGCTTCTCCCTGGATTTCAGGGAGGTATTGATGACTTCGGA
GCAGCCACGGTTCGAGCACTGATGCATTGGCAATACCGTACGATCTCTAGAGAACGAACTTCGATTCTTGACAACCTTAA
CGCTTTGCTCGGTCCCAAGACGCAAGAATATATCTCTTTCTATGGTTTGCGATCGTACGGACGGCTGTTTGAGGACGGTC
CAATTGCAACTAGCCAGATTTACGTGCACAGCAAGCTAATGATTGTTGATGACCGGATTGCGGTGATCGGATCTTCTAAT
ATAAACGATCGGAGCTTACTAGGCTCCAGAGACTCTGAGATCGGGGTTGTGATCGAAGACAAAGAATTCGTGGAATCTTC
AATGAACGGAGTGAAGTGGATGGCAGGGAAATTCTCTTACAGTCTTAGATGTTCCTTGTGGTCAGAGCATCTCGGCCTTC
ACCCTGGAGAGATGCAAAAGATCGAAGATCCAATCAAAGATGCAACATACAAGGACTTGTGGATGGCAACGGCTAAGAAG
AACACCGATATCTACGACCAAGTCTTCTCGTGCATCCCGAATGAACATATACGCTCAAGAGCTGCATTGAGACACAATAT
GTCTATTTGTAAAGACAAGTTGGGTCATACTACGATCGACCTTGGCATTGCACCGGAGAGGCTAGATTCATGCGGAAGCG
ACTCGTGGGAGATGCTGAAGGAGACAAGAGGGCACCTTGTGTGTTTCCCATTACAGTTTATGTGTGATCAAGAAGATCTC
AGACCGGTTTTCAACGAATCCGAGTTCTACACTGCTCCTCAAGTCTTCCACTGA