Details for Lyrate rockcress Locus 16037188

Position : sca3 ( 5`- 7426071 .. 7427971 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16037188

Protein [Map View]
MASSGDHDEIIKSISDAPPTHYMVKIESFSLLTKHAIERYETESFEAGGYKWKLVLYPNGNKSKNTKDHVSVYLALADSS
SLSPGWEVYAVFRLYLLDQNKDNYLILQGNERRFHAVKREWGFDKFIPTGTFSDASNGYLMEDTCMFGADVFVSKERRSG
RGECLSMIKDATSSKHVWKIENFSKLDKESYDSNAFFAGDRKWKVRFYPTGTKQGTGTHLSIYLTLVDPETISDGTKIFV
EFTIRIFDQLQGRHIAGKVTKWFSRSSSEHGWVKYVSMVYFTQPNSGLLLKDVCLVEADVCVHGITSAI*

DNA
ATGGCCAGTTCCGGTGATCATGATGAAATTATAAAGTCTATATCTGATGCCCCACCAACACATTACATGGTCAAGATAGA
GTCTTTCTCACTCCTTACAAAGCATGCTATAGAGAGATATGAAACTGAGAGCTTTGAAGCTGGAGGCTACAAATGGAAAC
TGGTTCTGTACCCAAATGGAAACAAGAGCAAGAATACGAAAGACCATGTTTCTGTTTACTTAGCTCTTGCGGACTCTAGT
TCACTAAGTCCAGGATGGGAGGTTTATGCAGTTTTTCGTCTGTACTTACTGGATCAAAACAAAGATAATTATTTGATTCT
ACAAGGAAACGAGAGACGGTTTCATGCGGTGAAGCGTGAATGGGGATTTGATAAATTCATCCCAACCGGTACCTTCTCTG
ATGCGTCAAATGGATACCTTATGGAAGACACATGTATGTTTGGAGCTGATGTGTTTGTTTCTAAGGAGAGAAGAAGTGGG
AGAGGAGAATGTTTATCAATGATTAAAGATGCTACTAGCTCTAAGCACGTCTGGAAAATTGAGAATTTCTCCAAGTTAGA
CAAAGAAAGCTATGACTCAAATGCTTTCTTCGCCGGAGATAGAAAATGGAAGGTAAGGTTTTATCCAACGGGAACGAAGC
AAGGAACAGGAACCCATCTTTCTATCTATCTAACCCTTGTAGATCCTGAAACCATTTCAGATGGTACAAAGATATTTGTA
GAGTTTACAATTCGAATATTTGATCAGTTACAAGGCAGACACATTGCCGGGAAAGTTACTAAATGGTTTAGTCGATCAAG
CTCGGAGCATGGATGGGTGAAATATGTATCGATGGTTTATTTCACACAGCCAAACAGTGGTCTGTTGCTCAAAGATGTCT
GTCTCGTTGAAGCTGATGTATGCGTTCATGGAATCACCAGTGCAATCTAA