Details for Lyrate rockcress Locus 16037141

Position : sca5 ( 5`- 17848534 .. 17846496 -3` )
Annotation : [B2G] alpha-soluble nsf attachment protein
External links : CoGe
PGDD synteny : 16037141

Protein [Map View]
MGDHLVRAEEFEKKAEKKLNGWGIFGSKYEDAADLLEKAANSYKLAKSWDQAGKAYLKLADCHLKSDSKHDAANAYAEAA
KCYKKVDTNEAASCLERAVNIFCEIGRLNMAARYYKEIAEYYESDQKFEQAIAYFEKAAEFFQNEEVTTSANQCNLKVAQ
YAAQLEQYEKAIKIYEDIARHSLNNNLLKYGVKGHLLTAGMCHLCKADVVSITNALEKYQDLDPTFSGTRECKFLADLAS
AIDEEDIAKFTDVVKEFDSMTPLDSWKTTMLLRVKEKLKAKELEEDDLT*

DNA
ATGGGGGATCATCTGGTGAGAGCTGAGGAATTTGAGAAGAAAGCTGAGAAGAAACTCAATGGATGGGGAATATTCGGATC
TAAGTACGAGGATGCTGCTGATCTGCTCGAAAAAGCAGCTAATTCCTATAAGCTCGCCAAATCATGGGATCAAGCTGGAA
AAGCTTATCTAAAACTTGCTGATTGTCACTTAAAGTCAGACAGCAAACATGATGCTGCTAACGCCTATGCTGAGGCTGCT
AAATGCTACAAGAAAGTTGACACAAATGAGGCTGCATCTTGCCTAGAGCGAGCAGTGAATATATTTTGTGAGATAGGAAG
GCTCAACATGGCTGCAAGATATTACAAGGAAATTGCTGAGTATTATGAATCTGATCAGAAGTTCGAGCAGGCGATTGCTT
ACTTTGAAAAGGCAGCTGAATTCTTTCAAAATGAAGAAGTGACCACTTCTGCAAACCAGTGCAATCTAAAGGTTGCACAA
TATGCTGCACAGCTGGAGCAATATGAGAAGGCAATCAAGATTTATGAAGATATAGCACGCCATTCACTCAACAATAACTT
GCTTAAGTATGGGGTTAAGGGCCATCTTCTCACTGCTGGCATGTGCCACTTATGCAAAGCTGATGTTGTTTCCATCACTA
ATGCGCTGGAGAAATACCAGGATCTGGATCCGACTTTTTCAGGAACACGGGAATGCAAGTTCTTAGCGGATCTTGCTTCT
GCTATTGATGAGGAAGACATTGCAAAGTTCACAGACGTTGTCAAGGAATTTGATAGCATGACTCCACTGGATTCATGGAA
GACAACCATGTTGTTGAGGGTGAAGGAGAAGCTCAAGGCCAAGGAGCTGGAGGAGGATGACCTTACCTAA