Details for Lyrate rockcress Locus 16037128

Position : sca3 ( 5`- 3299116 .. 3296933 -3` )
Annotation : [B2G] tbc domain-containing protein
External links : CoGe
PGDD synteny : 16037128

Protein [Map View]
MFGIQSRRDLTMELQSQIPILRPSIHARRANIVVKFQDLYGFTVEGNVDDVNVLNEVREKVRNQGRVWWALEASKGANWY
LQPEILLIGDGIALKTSLKISTLTNAITLKRLIRKGIPPVLRPKVWFSLSGAAKKKSTVPDSYYSDLTKAVDGKVTPATR
QIDHDLPRTFPGHPWLDTPEGHAALRRVLVGYSFRDSDVGYCQGLNYVAALLLLVMKTEEDAFWMLAVLLENVLVRDCYT
TNLSGCHVEQRVFKDLLAQKCPRIATHLEDMGFDVSLVATEWFLCLFSKSLPSETTLRVWDVLFYEGAKVLFHAALAIFK
MKENELLMTHQVGDVINILQKTSHQLFDPDELLTVAFEKIGSMTTNTISKQRKKQEPAVMAELDQRLRRLNSLKENGKST
*

DNA
ATGTTTGGGATCCAAAGCAGACGTGATTTGACGATGGAGCTACAATCTCAGATTCCGATTCTCCGTCCAAGCATCCACGC
GAGACGAGCCAACATCGTCGTGAAATTCCAGGACTTGTACGGTTTCACGGTGGAAGGAAATGTCGACGACGTCAATGTGT
TGAACGAAGTTAGAGAGAAAGTCAGGAACCAAGGACGAGTTTGGTGGGCGCTCGAAGCTAGCAAAGGAGCTAATTGGTAT
CTTCAGCCGGAGATTCTCTTGATCGGTGACGGAATCGCTTTGAAAACGTCTCTCAAGATCTCGACTTTGACGAATGCGAT
TACCTTGAAGAGATTGATTCGGAAAGGGATCCCACCTGTGCTTAGGCCTAAGGTTTGGTTTTCTCTTTCTGGTGCTGCTA
AGAAGAAGTCCACCGTCCCGGATAGTTATTACAGTGATTTGACCAAAGCCGTCGATGGCAAGGTCACACCGGCAACGAGG
CAGATTGATCATGATCTGCCACGCACTTTCCCAGGCCATCCATGGTTGGACACTCCAGAGGGTCATGCTGCTCTACGACG
TGTGCTTGTTGGTTATTCCTTTCGCGATTCCGATGTTGGCTATTGTCAGGGTCTAAACTACGTTGCAGCGTTACTATTGC
TTGTCATGAAGACAGAAGAAGACGCATTCTGGATGCTAGCAGTCCTTTTGGAAAACGTATTAGTCCGTGACTGTTACACA
ACCAACTTGTCTGGATGCCATGTTGAGCAGCGGGTTTTCAAAGATTTGCTTGCCCAAAAATGTCCTCGAATAGCTACTCA
TCTTGAAGATATGGGCTTTGATGTTTCCCTTGTAGCCACTGAATGGTTTCTATGCCTCTTCTCTAAAAGCCTTCCTTCAG
AGACAACTCTAAGGGTGTGGGATGTACTTTTCTATGAAGGAGCAAAGGTTCTATTCCATGCAGCGTTAGCAATATTCAAG
ATGAAAGAGAACGAGCTGCTTATGACCCACCAGGTTGGCGATGTAATCAACATATTACAGAAAACTTCACACCAGCTTTT
TGACCCGGATGAATTATTAACGGTGGCATTTGAGAAAATCGGATCGATGACTACCAACACCATATCAAAGCAGAGGAAGA
AGCAGGAACCAGCAGTGATGGCAGAACTTGATCAGAGACTTCGGAGACTCAACTCTCTGAAAGAAAATGGTAAGAGCACA
TAA