Details for Lyrate rockcress Locus 16037126

Position : sca1 ( 5`- 29180815 .. 29181788 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16037126

Protein [Map View]
MASSSKICRLSSKIHSLTQKLSKTNVHASSLPSPIKSSSPSSATTRINQSFRLPVELSSCLSMLPLHSAIASARLISSLS
VESKSWTLVPQGISMPL*

DNA
ATGGCGTCTTCTTCTAAAATCTGCAGATTATCATCAAAGATTCATTCTTTAACCCAGAAGCTTAGCAAGACGAATGTTCA
CGCTTCCTCCTTACCCTCTCCCATTAAATCTTCATCTCCATCCTCAGCAACCACTCGTATCAATCAATCTTTTAGATTAC
CAGTGGAGCTAAGTAGCTGTCTATCGATGTTGCCACTACACAGTGCTATAGCATCTGCCAGATTGATATCAAGTTTGTCT
GTTGAGTCTAAGAGCTGGACTTTAGTTCCTCAAGGTATTTCGATGCCTTTATGA