Details for Lyrate rockcress Locus 16037104

Position : sca3 ( 5`- 6507449 .. 6508598 -3` )
Annotation : [B2G] ATNAC3 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16037104

Protein [Map View]
MGLQELDPLAQLSLPPGFRFYPTDEELMVEYLCRKAAGHDFSLQLIAEIDLYKFDPWVLPSKALFGEKEWYFFSPRDRKY
PNGSRPNRVAGSGYWKATGTDKVISTEGRRVGIKKALVFYIGKAPKGTKTNWIMHEYRLIEPSRRNGSTKLDDWVLCRIY
KKQSSAQKQAYNNLMTSGREYSNNGSSTSSSSHQYDDVLESLHEIDNRSLGFAAGSSNSLPRCHRPVLTNQKTGFHGLAR
EPSFDWANLVGQNSVPELGLSQNVPSLRYGDGGTQQQAEGIPRFNYNSDVLAHQGFSVDPVNGFGYSGQQSSGFGFI*

DNA
ATGGGTCTCCAAGAGCTTGACCCCTTAGCCCAATTGAGCTTACCACCGGGTTTTCGATTTTACCCGACGGACGAAGAGCT
GATGGTTGAATATCTCTGTAGAAAAGCCGCCGGTCATGACTTCTCTCTCCAGCTCATAGCTGAAATTGATCTCTACAAGT
TTGATCCATGGGTTTTACCAAGTAAAGCGTTATTCGGTGAAAAAGAATGGTATTTTTTCAGCCCAAGGGATAGGAAGTAT
CCGAACGGGTCGAGACCTAATCGGGTTGCCGGATCGGGTTATTGGAAAGCCACCGGTACTGATAAAGTTATCTCGACGGA
GGGAAGAAGAGTTGGTATCAAGAAAGCTTTAGTGTTTTACATTGGAAAAGCACCGAAAGGAACCAAAACCAATTGGATTA
TGCATGAGTACCGTCTCATCGAACCCTCTCGTAGAAATGGAAGCACCAAGCTTGATGATTGGGTTTTATGTCGAATATAC
AAAAAGCAATCAAGCGCACAAAAACAGGCTTACAATAATCTAATGACGAGTGGTCGTGAATACAGCAACAATGGTTCGTC
GACATCTTCTTCCTCTCATCAATACGACGACGTGCTCGAGTCTTTGCATGAAATAGACAACAGAAGTTTGGGATTCGCCG
CCGGTTCATCAAACTCGCTGCCTCGTTGTCATAGACCGGTTTTAACCAATCAGAAAACCGGGTTTCACGGTTTAGCTAGG
GAGCCAAGTTTTGATTGGGCGAATTTGGTTGGACAGAACTCGGTCCCGGAACTCGGACTGAGTCAAAACGTTCCGAGTCT
CCGTTACGGTGACGGTGGAACGCAGCAGCAGGCAGAGGGGATTCCTCGGTTTAATTATAACTCGGACGTGTTGGCTCATC
AGGGTTTTAGTGTTGATCCGGTTAACGGATTTGGGTATTCAGGTCAACAATCTAGTGGTTTCGGGTTTATTTGA