Details for Lyrate rockcress Locus 16037092

Position : sca3 ( 5`- 5696496 .. 5694964 -3` )
Annotation : [B2G] scarecrow transcription factor family protein
External links : CoGe
PGDD synteny : 16037092

Protein [Map View]
MLLEETEPPNQTLDHVLSWLEDSVSLSPLPGFDDSYLLHEFDGTQTWEWDQTQDPEHGFIQSYSQDLSAYVGFEATNLEV
VTEAPSIDLDPPPELQQQNDQSRKRSRDGVIEAQQVKKSARSKRKAIKSSEKSSKDGNKEGRWAEKLLNPCALAITASNS
SRVQHYLCVLSELASSSGDANRRLAAFGLRALQHHLSSSSSVSSSFWPVFTFASAEVKMFQKTLLKFYEVSPWFALPNNM
ANSAILQILAQDPIYKKDLHILDIGVSHGMQWPTLLEALSCRPEGPPPCVRITVVSDLTADIPFSVGPPAYNYGSQLLGF
ARSLKINLQISVLDKFQLIDTSPHETLIVCVQFRLHPLKHSIPDERGETLKALRSLRPKGVVLCENNGECSASGDFAAGF
SKKLEYLWKFLDSTSSGFKEENSEERKLMEGEATKVLMNTGEMNEGKDKWYERMREAGFAAEAFGEDAIDGAKSLLRKYD
NNWEVRMEDGDTYAGLMWKGEAVSFCSLWK*

DNA
ATGTTGTTGGAAGAAACAGAACCACCAAACCAGACTCTAGATCATGTCCTAAGCTGGCTTGAGGATTCTGTGTCCTTATC
CCCATTACCAGGATTTGATGATTCTTATTTGCTCCACGAGTTTGATGGGACTCAAACGTGGGAATGGGATCAGACTCAAG
ATCCGGAACATGGTTTTATTCAAAGCTATAGTCAAGATCTTAGTGCATATGTGGGTTTTGAAGCAACTAACCTGGAAGTG
GTAACAGAAGCTCCATCCATTGATTTGGATCCTCCACCTGAACTTCAGCAACAAAATGATCAGTCCAGGAAAAGGAGCCG
CGACGGGGTTATCGAGGCACAACAGGTGAAAAAATCGGCAAGGAGCAAGAGAAAAGCAATCAAGTCTAGTGAGAAGAGCA
GCAAAGATGGTAACAAGGAAGGTAGATGGGCAGAGAAATTGCTTAACCCTTGTGCCTTGGCCATTACGGCAAGTAACTCA
TCAAGGGTTCAACATTACCTTTGTGTTCTCTCTGAACTGGCCTCTTCTTCTGGCGATGCTAATCGTCGGCTTGCAGCTTT
TGGTCTTCGGGCTTTGCAACATCATCTTTCCTCATCATCCTCTGTGTCATCATCTTTTTGGCCTGTTTTTACTTTTGCTT
CAGCAGAAGTGAAGATGTTTCAAAAGACTCTGCTTAAGTTCTACGAGGTAAGCCCTTGGTTTGCTTTGCCTAATAACATG
GCAAACTCAGCTATCCTGCAGATTCTAGCACAGGATCCCATATATAAAAAGGATCTTCATATTCTTGATATTGGTGTTTC
TCACGGTATGCAATGGCCCACTTTGTTGGAGGCTCTGAGCTGCAGACCAGAAGGACCTCCTCCTTGTGTTCGAATAACCG
TTGTATCTGATCTAACCGCAGACATACCTTTCTCTGTTGGTCCACCAGCTTACAATTATGGTTCTCAACTCCTTGGCTTT
GCTCGGTCTCTCAAGATCAACCTTCAGATTAGTGTACTTGACAAGTTCCAGCTCATTGATACCTCACCTCACGAGACCTT
AATAGTCTGTGTTCAGTTTAGGCTGCATCCCCTGAAGCATAGCATCCCTGATGAGAGAGGCGAGACTTTGAAAGCACTGA
GAAGTTTGAGGCCAAAAGGAGTGGTCCTTTGTGAGAACAATGGAGAATGTAGTGCCAGTGGGGACTTTGCAGCAGGATTC
TCGAAGAAACTTGAGTATCTATGGAAGTTTCTGGATTCAACAAGCTCAGGATTTAAAGAAGAGAATAGTGAAGAGAGAAA
ACTAATGGAAGGAGAGGCAACAAAGGTGTTGATGAATACAGGAGAGATGAATGAAGGAAAAGATAAATGGTATGAAAGGA
TGAGAGAAGCTGGTTTTGCCGCAGAAGCATTTGGAGAAGATGCAATTGATGGAGCCAAATCTTTACTGAGAAAGTATGAC
AACAACTGGGAAGTAAGAATGGAAGATGGAGATACCTATGCTGGATTAATGTGGAAAGGAGAGGCAGTTTCCTTTTGTTC
ATTGTGGAAGTAG