Details for Lyrate rockcress Locus 16037070

Position : sca3 ( 5`- 3630246 .. 3632087 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_478229 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16037070

Protein [Map View]
MALSMESGFSIGSCFKAPNPPVLISASPKKINFTSRRRSKRFLFRVSAVSYKEFAESALEETRKRIVLEPSHLQEKYSSM
TGLDGRTELRMLAFKSSKIRLLRSMAIENETMQVFDFAGFMEPEYDTPIFCANFFTSANVNIVVLDLNPLHQLTDQTDYQ
DKYYNKIMSIYHKYAETFPWGGKLTGESIKFFSPLVMWTRFSSSQEKHKALFSAFLEYYQAWLEMTIQVREEMEPSQVRA
NCEAQHKYLTWRAQKDPGHGLLKRLVGEEKAKELLRDFLFNGVDELGTKTFIDYFPEYQTEDGTVNDKRSIIGKSYETRP
WDLTGQFIG*

DNA
ATGGCTTTGTCAATGGAGTCTGGATTTTCAATTGGGTCGTGCTTCAAGGCACCAAACCCTCCTGTTCTAATCTCTGCAAG
CCCTAAGAAGATCAATTTCACGTCGAGAAGGAGAAGTAAAAGATTCTTATTTAGAGTCTCTGCTGTTTCCTATAAGGAAT
TCGCAGAGTCTGCTTTAGAAGAAACCAGGAAAAGGATCGTTCTTGAACCTTCACATCTCCAGGAAAAGTATAGTAGCATG
ACAGGATTGGATGGGAGGACGGAACTTCGAATGCTTGCTTTTAAATCTTCAAAGATTAGACTCTTGAGGAGCATGGCCAT
AGAGAATGAGACAATGCAGGTCTTTGACTTTGCAGGTTTCATGGAGCCTGAGTATGATACTCCCATATTCTGTGCTAACT
TTTTCACATCTGCCAACGTGAACATAGTTGTATTGGACCTTAATCCTTTGCATCAGTTGACTGACCAGACGGATTACCAA
GACAAGTATTATAACAAGATCATGTCCATATATCACAAATATGCTGAGACTTTCCCATGGGGAGGGAAATTGACTGGTGA
ATCCATAAAGTTTTTTTCGCCTTTGGTGATGTGGACCAGGTTTTCGTCTAGCCAAGAAAAACATAAGGCTTTGTTCTCTG
CGTTTCTGGAGTACTATCAGGCATGGCTTGAGATGACAATCCAAGTTAGGGAGGAGATGGAACCATCTCAGGTGAGAGCC
AATTGTGAAGCACAACACAAGTACCTGACATGGCGAGCACAAAAGGATCCTGGACATGGTCTTCTTAAAAGATTAGTTGG
TGAAGAAAAGGCAAAGGAGCTGCTAAGGGATTTCCTGTTCAATGGGGTGGATGAGTTAGGCACAAAAACATTCATTGATT
ACTTTCCAGAGTACCAAACAGAAGATGGAACTGTAAACGATAAACGAAGTATCATTGGGAAGTCATATGAAACTCGGCCA
TGGGATTTAACAGGACAATTTATCGGCTAA