Details for Lyrate rockcress Locus 16037036

Position : sca3 ( 5`- 7665850 .. 7666697 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16037036

Protein [Map View]
MQDPHVPSSPTISSVSSSDLDTESTGSFFHDRSITLGTLMGFSFTATMPMPFRASSHRHGHVSPSVAVSRASSSNARRHH
QRKRPPLNSAEPHQRHRRRKWWRFCRDDDDDAGIHRATGDSKRSSLGEYLEVERRFGDEAVYNSAEAELEGAVVARYQDQ
QPVMGERALFSDGRVLPPASVEAVTGEGTPVASALCRFPVSLTGICSGGGG*

DNA
ATGCAAGATCCTCATGTGCCATCTTCTCCCACCATCTCCTCCGTCTCTTCCTCCGATCTTGATACCGAGTCTACAGGATC
GTTCTTCCATGACAGAAGCATCACACTGGGAACGCTTATGGGATTTAGTTTCACTGCAACTATGCCGATGCCATTTAGAG
CTTCTTCGCACCGCCACGGCCACGTGTCACCCTCCGTCGCAGTCTCACGAGCTTCCAGCTCCAATGCAAGACGCCACCAC
CAGAGGAAGCGTCCTCCTTTAAATTCGGCTGAGCCTCATCAGCGGCATCGCCGTCGCAAGTGGTGGCGCTTTTGCCGAGA
TGACGATGACGACGCCGGAATCCACCGTGCCACCGGAGATTCAAAGCGGTCATCGCTCGGGGAATATCTAGAGGTGGAAC
GGAGGTTTGGAGATGAAGCCGTTTACAACTCCGCCGAAGCAGAGTTAGAGGGTGCGGTGGTGGCGCGGTACCAAGATCAG
CAGCCGGTGATGGGGGAGCGGGCATTGTTCTCTGACGGAAGGGTTCTTCCTCCGGCTTCAGTTGAAGCTGTTACCGGAGA
AGGTACGCCGGTGGCCTCGGCTCTTTGTAGATTCCCGGTTTCTTTAACCGGTATATGCAGTGGTGGCGGAGGATAA