Details for Lyrate rockcress Locus 16037017

Position : sca3 ( 5`- 4807062 .. 4808099 -3` )
Annotation : [B2G] universal stress protein family protein
External links : CoGe
PGDD synteny : 16037017

Protein [Map View]
MAEDQATTAVETSAVEKQPETTREAEPPSLTTKRMVVAIDESDSSFYALQWVIDHFSNLLLTTEAAEAESGMLTVVHVQS
PYYHFAAFPAGPGGATAVYASSTMIESVKKAQQETSAALLSRALQMCRAKQIRTETLVLEGDAKEMICEAVEQMHVDLLV
VGSRGLGKIKRAFLGSVSDYCAHHANCPILIVKPPKEMTK*

DNA
ATGGCGGAAGATCAAGCAACGACGGCAGTGGAAACATCGGCGGTGGAGAAGCAGCCAGAGACGACGAGAGAGGCTGAACC
ACCAAGTTTGACGACAAAGAGGATGGTGGTTGCGATCGATGAGAGCGACTCGAGTTTCTACGCTCTTCAGTGGGTCATTG
ACCATTTCTCTAATCTTTTACTGACCACTGAGGCAGCTGAGGCGGAAAGTGGAATGCTCACGGTGGTTCATGTGCAGTCC
CCTTACTATCACTTTGCTGCCTTTCCGGCTGGACCTGGTGGCGCCACAGCAGTGTACGCATCTTCGACAATGATAGAGTC
AGTGAAAAAAGCACAACAAGAGACCTCTGCTGCGCTTCTCTCTCGTGCTCTCCAAATGTGCAGAGCCAAACAGATACGTA
CTGAAACTCTGGTGCTCGAAGGCGACGCGAAGGAGATGATTTGCGAGGCAGTGGAGCAAATGCACGTTGATCTTCTCGTT
GTCGGTAGTCGTGGCCTTGGCAAGATCAAAAGAGCGTTTCTTGGGAGCGTTAGTGATTACTGCGCTCATCACGCCAACTG
CCCCATCCTTATTGTCAAGCCACCTAAGGAGATGACTAAGTAA