Details for Lyrate rockcress Locus 16037011

Position : sca3 ( 5`- 1904216 .. 1905815 -3` )
Annotation : [B2G] phosphoglycerate bisphosphoglycerate mutase family protein
External links : CoGe
PGDD synteny : 16037011

Protein [Map View]
MSPDNKLLPKRIILVRHGESEGNLDTTAYTTTPDHKIQLTDSGLLQAQEAGARLHALISSNPSSPEWRVYFYVSPYDRTR
STLREIGRSFSRRRVIGVREECRIREQDFGNFQVKERMRATKKVRERFGRFFYRFPEGESAADVFDRVSSFLESLWRDID
MNRLHINPSHELNFVIVSHGLTSRVFLMKWFKWTVEQFEGLNNPGNSEIRVMELGQGGDYSLAIHHTEEELATWGLSPEM
IADQKWRVNAHKGEWKEDCKWYFGDFFDHMADSDREYETEANEEKEEEEEEEEEEEGKRVNLLTSSEYSNEPELYNGKCC
*

DNA
ATGAGTCCTGACAATAAACTGCTTCCGAAGCGGATCATCCTCGTACGGCACGGTGAATCGGAAGGGAATCTCGACACGAC
GGCGTATACAACGACGCCGGATCATAAGATCCAGTTAACGGATTCCGGTTTGCTTCAGGCGCAGGAAGCCGGAGCTCGTC
TCCACGCTTTGATCTCTTCAAATCCTTCTTCACCGGAGTGGCGTGTGTACTTCTACGTTTCGCCGTACGATCGGACTCGA
TCTACGCTCCGGGAGATCGGACGGTCGTTCTCGCGTCGCCGTGTGATTGGTGTTCGCGAAGAATGTCGAATTAGGGAACA
GGATTTTGGGAATTTCCAGGTTAAAGAGCGAATGAGAGCAACGAAGAAGGTGAGAGAGAGGTTTGGCCGCTTTTTCTACC
GGTTCCCGGAGGGAGAATCCGCCGCCGACGTCTTCGATCGCGTCTCCAGTTTTCTCGAGTCTCTATGGAGAGACATCGAC
ATGAACAGACTACACATCAACCCGTCTCATGAGCTAAACTTTGTGATTGTCTCACACGGCTTAACATCGCGTGTGTTTCT
GATGAAATGGTTCAAGTGGACCGTGGAACAGTTTGAAGGACTAAACAATCCAGGGAACAGTGAGATTAGAGTAATGGAAT
TAGGACAAGGCGGTGATTACAGCTTGGCGATTCATCACACAGAGGAAGAGTTAGCCACATGGGGACTGTCACCAGAGATG
ATTGCAGATCAAAAGTGGCGGGTTAACGCGCATAAAGGCGAATGGAAAGAAGATTGTAAGTGGTATTTTGGTGATTTCTT
CGATCATATGGCAGATTCGGATAGAGAGTATGAGACTGAGGCCAATGAAGAAAAAGAAGAAGAAGAAGAAGAAGAAGAAG
AAGAAGAGGGAAAAAGGGTAAATCTGCTAACGAGTTCAGAATATAGCAATGAGCCAGAGTTATACAATGGAAAATGCTGC
TGA