Details for Lyrate rockcress Locus 16037003

Position : sca3 ( 5`- 8540629 .. 8535851 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_479490 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16037003

Protein [Map View]
MSDVAVTVEKMSEEEDDAAIEERWSLYEAYNELHALAQELETPFEAPAVLVVGQQTDGKSALVEALMGFQFNHVGGGTKT
RRPITLHMKYDPQCQFPLCHLGSDDDPSVSLPKSLSQIQAYIEAENMRLEQEPCPFSSKEIIVKVQYKYCPNLTIIDTPG
LIAPAPGLKNRALQVQARAVEALVRAKMQHKEFIILCLEDSSDWSIATTRRIVMQVDPELSRTIVVSTKLDTKIPQFSCS
SDVEVFLSPPASALDSSLLGDSPFFTSVPSGRVGYGQDSVYKSNDEFKKAVSLREVEDIASLEKKLGRFLTKQEKSRIGI
SKLRLFLEELLWKRYKESVPLIIPLLGKEYRSTVRKLDTVSKELSSLDEAKLKERGRTFHDLFLTKLSLLLKGTVVAPPD
KFGETLQDERTQGGAFVGTDGLQFPHKLIPNAGMRLYGGAQYHRAMAEFRFLVGAIKCPPITREEIVNACGVEDIHDGTN
YSRTACVIAVAKARETFEPFLHQLGARLLHILKRLLPISVYLLQKEGEYLSGHEVFLKRVASAFNSFVESTEKSCRDKCM
EDLASTTRYVTWSLHNKNRAGLRQFLDSFGGTEQLTTSGNAIGFSLPQDAPGGTTDTKVRSDVKLSHLASNIDSGSSIQT
TEMRLADLLDSTLWNRKLAPSSERIVYALVQQIFQGIREYFLASAELKFNCFLLMPIVDKLPALLREELENAFEDDLDSI
FDITNLRQSLDQKKRSTEIELRRIKRIKEKFRVMNEKLNSHEFAQNLKAPSVQQ*

DNA
ATGTCGGATGTGGCAGTGACGGTTGAGAAAATGTCGGAGGAGGAGGACGACGCTGCGATTGAGGAGCGGTGGAGTCTTTA
CGAAGCTTACAATGAGTTACACGCTTTGGCGCAGGAATTGGAGACGCCGTTCGAAGCACCGGCGGTTCTTGTGGTGGGAC
AGCAGACGGACGGTAAGAGTGCGCTTGTTGAAGCTCTCATGGGGTTTCAATTTAACCACGTCGGCGGCGGAACCAAGACT
CGCCGGCCGATTACTCTTCATATGAAGTACGATCCTCAGTGTCAATTCCCGCTTTGTCATCTCGGATCTGATGATGATCC
TTCCGTTTCCCTTCCCAAATCTCTCTCACAAATTCAGGCGTATATTGAAGCCGAGAACATGAGGCTGGAGCAAGAGCCAT
GCCCATTCTCTTCCAAGGAGATTATTGTGAAAGTGCAGTATAAGTACTGTCCCAACCTTACCATCATTGATACACCTGGA
CTTATAGCTCCTGCACCAGGACTGAAAAACCGAGCTCTCCAGGTTCAAGCACGGGCTGTGGAAGCTCTAGTCCGAGCAAA
GATGCAACACAAAGAGTTCATTATATTATGCCTCGAAGATAGCAGTGACTGGAGCATTGCAACTACTCGGAGGATAGTGA
TGCAAGTTGATCCTGAGCTTTCTAGGACAATTGTTGTTTCTACAAAGCTTGACACCAAAATCCCTCAATTCTCATGTTCA
TCCGACGTGGAAGTCTTCCTCTCACCTCCTGCAAGCGCACTTGACAGCTCCTTATTGGGCGATTCTCCTTTTTTCACTTC
TGTGCCTTCTGGAAGAGTTGGCTATGGACAGGATTCAGTATATAAGTCTAATGACGAGTTCAAAAAGGCTGTGTCACTTA
GAGAAGTGGAAGACATTGCATCTTTAGAGAAGAAGTTGGGCCGTTTTCTGACAAAACAGGAAAAGAGTAGGATTGGCATC
AGTAAACTGAGGTTGTTTCTCGAAGAACTACTTTGGAAAAGGTACAAAGAGAGTGTTCCATTGATCATTCCACTGTTAGG
AAAGGAGTACCGCAGTACAGTCAGAAAGCTCGATACCGTTAGCAAGGAACTTAGCTCTTTAGATGAAGCAAAACTCAAAG
AGAGAGGCAGGACTTTCCATGATCTCTTCTTAACCAAGTTATCGCTGTTATTGAAAGGAACAGTTGTGGCCCCTCCAGAT
AAATTTGGTGAAACATTGCAAGATGAAAGGACACAAGGAGGCGCATTTGTTGGTACTGATGGTCTCCAGTTCCCACATAA
GCTAATACCAAATGCAGGGATGCGTCTCTATGGGGGTGCACAGTATCATCGTGCCATGGCTGAGTTTCGTTTTCTAGTTG
GTGCTATCAAATGTCCCCCGATAACACGGGAGGAAATTGTAAATGCATGTGGAGTTGAGGATATTCATGATGGAACAAAC
TATTCCAGAACAGCTTGTGTTATAGCAGTTGCAAAGGCTCGTGAGACGTTTGAACCTTTCCTTCATCAGTTGGGGGCGAG
GCTTCTACACATTCTCAAGAGATTGCTTCCAATTTCTGTATATCTTCTTCAGAAAGAAGGTGAATACTTAAGTGGGCATG
AGGTGTTTCTTAAGCGGGTTGCTTCAGCTTTCAACAGTTTTGTGGAGTCCACAGAGAAATCATGTCGTGACAAATGTATG
GAAGACTTAGCAAGTACGACTCGCTATGTTACATGGTCTCTTCACAACAAGAACCGAGCTGGTCTACGTCAATTCTTGGA
CTCATTTGGCGGAACAGAGCAACTTACTACATCAGGTAATGCCATAGGATTTAGCCTTCCCCAAGATGCACCAGGTGGCA
CAACAGACACAAAGGTAAGATCAGATGTAAAGCTAAGCCATCTCGCCTCAAACATCGATTCAGGTTCCAGTATTCAGACA
ACAGAAATGCGGTTGGCTGATCTTCTAGATAGCACGCTTTGGAACCGCAAGCTTGCTCCTTCCTCTGAGAGAATTGTGTA
CGCATTGGTTCAACAGATATTCCAGGGCATACGAGAATACTTTCTCGCCTCTGCTGAGTTAAAGTTCAACTGTTTTCTTC
TGATGCCCATTGTTGATAAGTTACCTGCTCTTCTCCGGGAGGAGTTGGAAAACGCATTTGAAGACGACCTCGATAGTATC
TTCGACATCACGAATCTCCGGCAATCACTTGATCAAAAGAAACGGAGCACAGAGATCGAGCTCAGAAGGATAAAGAGGAT
AAAAGAGAAATTCAGAGTGATGAATGAGAAGCTAAACTCTCACGAATTTGCTCAAAATCTAAAGGCACCTTCGGTGCAGC
AGTGA