Details for Lyrate rockcress Locus 16037001

Position : sca3 ( 5`- 9630836 .. 9627826 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_479696 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16037001

Protein [Map View]
MAASFSVPSMIMEEEGRFEAEVAEVQTWWASERFKLTRRPYTARDVVALRGHLKQGYASNEMAKKLWRTLKSHQANGTAS
RTFGALDPVQVTMMAKHLDTIYVSGWQCSSTHTSTNEPGPDLADYPYDTVPNKVEHLFFAQQYHDRKQREARMSMSREER
TKTPFVDYLKPIIADGDTGFGGTTATVKLCKLFVERGAAGVHIEDQSSVTKKCGHMAGKVLVAVSEHINRLVAARLQFDV
MGTETVLVARTDAVAATLIQSNIDARDHQFILGVTNPSLRGKSLSSLLAEGMTVGKNGPALQSIEDQWLTSAGLMTFSEA
VVQAIKRMNLNENEKNQRLNEWLTHARYENCLSNEQGRELAAKLGVTDLFWDWDLPRTREGFYRFQGSVAAAVVRGWAFA
QIADIIWMETASPDLNECTQFSEGIKSKTPEVMLAYNLSPSFNWDASGMTDQQMVEFIPRIARLGYCWQFITLAGFHADA
LVVDTFAKDYARRGMLAYVERIQREERTHGVDTLAHQKWSGANYYDRYLKTVQGGISSTAAMGKGVTEEQFKESWTRPGA
DGMGEGTSLVVAKSRM*

DNA
ATGGCTGCATCTTTCTCTGTCCCCTCTATGATAATGGAAGAAGAAGGGAGATTCGAGGCGGAGGTTGCGGAAGTGCAGAC
TTGGTGGGCCTCAGAGAGGTTCAAGCTAACAAGGCGTCCTTACACTGCCCGTGACGTGGTGGCTCTACGTGGCCATCTCA
AGCAAGGCTACGCTTCGAACGAGATGGCTAAGAAGCTGTGGCGAACGCTCAAAAGTCACCAAGCCAACGGCACGGCCTCT
CGCACGTTTGGTGCGTTGGACCCTGTTCAGGTGACCATGATGGCTAAACATTTGGACACCATCTACGTCTCTGGTTGGCA
GTGCTCGTCAACTCACACCTCCACTAACGAGCCTGGTCCTGATCTTGCTGACTATCCATACGACACCGTTCCTAACAAGG
TTGAACACTTATTCTTCGCTCAGCAGTACCATGACAGAAAGCAGAGGGAAGCAAGAATGAGCATGAGCAGAGAAGAGAGG
ACAAAAACTCCGTTCGTGGACTACCTGAAGCCCATCATAGCCGACGGAGACACTGGTTTTGGCGGCACCACCGCCACCGT
CAAACTTTGCAAGCTCTTCGTTGAGAGAGGTGCCGCTGGAGTCCACATCGAGGACCAGTCCTCAGTCACAAAGAAGTGTG
GTCACATGGCCGGAAAAGTCCTTGTGGCAGTCAGCGAACACATCAACCGCCTTGTGGCGGCGCGGCTCCAGTTCGACGTG
ATGGGTACAGAGACCGTCCTGGTCGCTAGAACGGACGCGGTCGCAGCTACTCTGATCCAGTCGAACATTGACGCGAGGGA
CCACCAGTTCATCCTCGGTGTCACTAACCCGAGCCTTAGAGGCAAGAGTTTGTCCTCGCTTCTCGCCGAGGGAATGACGG
TAGGCAAGAACGGTCCGGCATTGCAATCCATTGAGGATCAATGGCTTACCTCGGCCGGTCTTATGACTTTCTCGGAAGCT
GTCGTTCAGGCCATCAAGCGCATGAACCTCAACGAGAATGAGAAGAATCAGAGACTGAACGAGTGGCTAACCCATGCAAG
GTATGAGAACTGTCTGTCAAATGAGCAAGGCCGAGAATTAGCAGCAAAACTCGGGGTGACGGATCTCTTCTGGGACTGGG
ACTTACCAAGAACCAGAGAAGGATTCTACCGGTTCCAAGGCTCGGTCGCAGCGGCCGTGGTCCGTGGCTGGGCCTTTGCA
CAAATCGCAGACATCATCTGGATGGAAACCGCAAGCCCTGATCTCAATGAATGCACCCAGTTCTCAGAAGGTATCAAGTC
CAAGACACCGGAGGTCATGCTCGCCTACAATCTCTCGCCGTCTTTCAACTGGGACGCTTCCGGTATGACGGATCAGCAGA
TGGTGGAGTTCATTCCGCGGATTGCTAGGCTCGGATATTGTTGGCAGTTCATAACGCTTGCGGGTTTCCATGCGGACGCT
CTTGTGGTTGATACATTTGCAAAGGATTACGCGAGACGAGGGATGTTGGCTTATGTGGAGAGGATACAGAGAGAAGAGAG
GACCCATGGGGTTGACACTTTGGCTCATCAAAAATGGTCAGGTGCTAATTACTATGATCGTTATCTTAAGACCGTCCAAG
GTGGAATCTCCTCCACTGCAGCAATGGGCAAAGGTGTCACTGAAGAACAGTTCAAGGAGAGTTGGACAAGGCCGGGAGCT
GATGGAATGGGCGAAGGGACTAGCCTTGTGGTCGCCAAGTCCAGAATGTAA