Details for Lyrate rockcress Locus 16036984

Position : sca3 ( 5`- 7250514 .. 7249644 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16036984

Protein [Map View]
MEKRGMIDTWIDKHRSIYTAATRHAFVVSIRDGSVDLSSFRTWLGQDYLFVRGFVPFVASVLIKACKDSGESSDMEVVLG
GLASLNDEIEWFKKEGTKWDVDFSTVVPQNANQEYRRFLEALMSSEVKYPVIMTAFWAIEAVYQESFAHCLEDGNKTPVE
LTGACHRWGNDGFKQYCLSVKNIAERCLENASGEVLVEAEDVLVRVLEHEVAFWEMSRGGQ*

DNA
ATGGAGAAGAGAGGAATGATCGACACGTGGATTGATAAGCACCGTTCGATCTATACGGCGGCTACACGTCATGCTTTTGT
CGTCTCGATTCGCGACGGATCCGTTGATCTCTCGTCCTTCAGAACTTGGCTGGGGCAAGATTATCTGTTCGTGAGGGGAT
TTGTGCCGTTTGTAGCGAGTGTGTTGATCAAAGCTTGCAAAGATTCCGGCGAGAGTTCCGATATGGAAGTGGTGCTTGGT
GGTTTGGCGTCGTTGAATGATGAAATTGAATGGTTTAAAAAAGAAGGAACGAAATGGGATGTTGATTTCTCGACCGTTGT
GCCTCAAAATGCTAATCAAGAATATCGCAGGTTTTTGGAAGCTCTGATGAGTAGTGAGGTGAAGTATCCAGTGATTATGA
CAGCTTTCTGGGCAATTGAAGCAGTGTATCAAGAGAGCTTTGCTCATTGTTTAGAAGACGGGAACAAAACTCCGGTGGAG
CTTACCGGAGCTTGTCATCGGTGGGGGAATGACGGGTTTAAACAGTATTGTTTGTCTGTCAAGAACATTGCTGAACGTTG
TTTGGAGAATGCATCCGGAGAGGTGCTCGTTGAAGCTGAAGATGTGCTTGTACGAGTTCTTGAACACGAGGTCGCCTTCT
GGGAGATGAGCCGTGGAGGACAGTAA