Details for Lyrate rockcress Locus 16036968

Position : sca3 ( 5`- 4210885 .. 4211052 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16036968

Protein [Map View]
ICKKKLQRTNETLSLELWKHSGSELRRAITHETNANGVVVPSVSYLKTCGLWSQQ*

DNA
ATTTGCAAAAAAAAATTACAAAGGACAAATGAAACTCTGAGTTTGGAACTTTGGAAGCACAGTGGGAGTGAATTAAGGAG
GGCCATAACTCATGAAACAAACGCAAATGGTGTTGTCGTACCATCGGTCTCCTATCTAAAGACGTGTGGGTTATGGTCTC
AACAATAA