Details for Lyrate rockcress Locus 16036966

Position : sca3 ( 5`- 702452 .. 701721 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16036966

Protein [Map View]
MASLATTLALILFLICHLTPETALARPLNDQKPVDGVVTTTTDEAKNLAFVSDPFPSLQSSPPTSAIPGSPGFTLPFPFP
SSPGGIPGIPGSPGFRLPFPFPSSPGGIPGIPGSPGFRLPFPFPSSPGGIPGIRGSPGFRLPFPFPSSPSGGGIPGIPGI
PGFPSFRFPPLPIPFPPLPIPSSPLAGGGIPGIPGIPGIPGIPGFPGFRFPPLPFLPPSTQ*

DNA
ATGGCATCTTTAGCGACCACTCTAGCCCTAATTCTTTTCTTGATCTGCCACCTCACACCAGAAACAGCTCTAGCTCGCCC
TCTCAACGATCAGAAGCCGGTTGATGGAGTCGTAACCACCACCACCGACGAAGCCAAAAACCTAGCCTTTGTATCTGATC
CGTTCCCTAGTTTGCAGTCATCACCTCCAACATCAGCTATTCCTGGTTCTCCTGGCTTCACGCTTCCGTTTCCATTCCCG
TCATCACCAGGAGGTATTCCCGGTATTCCAGGTTCCCCTGGGTTTAGGCTTCCGTTTCCATTTCCGTCATCACCAGGAGG
TATTCCCGGTATTCCTGGTTCCCCTGGCTTTAGGCTTCCGTTTCCATTTCCATCATCACCAGGAGGTATTCCCGGTATTC
GTGGTTCCCCTGGCTTTAGACTTCCGTTTCCATTCCCATCATCACCATCAGGAGGAGGTATTCCCGGTATTCCTGGTATT
CCCGGTTTCCCTTCCTTTAGGTTTCCTCCGTTACCAATCCCGTTTCCTCCGTTACCAATCCCATCATCACCTCTAGCAGG
AGGTGGTATTCCTGGTATTCCCGGTATTCCTGGTATTCCCGGTATTCCTGGTTTCCCTGGATTTAGATTTCCTCCGTTAC
CGTTCCTCCCACCGTCGACTCAGTGA