Details for Lyrate rockcress Locus 16036965

Position : sca3 ( 5`- 3507874 .. 3508939 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16036965

Protein [Map View]
MDQILNKVGSYWLGKKANKQLDSVGDDINSLSTSIEGGTKWLVNKIKGKMQKPLPELLKEFGLPVGIFPRDATNYEFNEQ
TRKLTVFIPSICEVGYKDSSVLRFTTTVTGFLEKGKLADVEGMKTKVMIWVKVTSISADSSKVHFTAGMKKIRSRDAYEV
LRDGVEIDKF*

DNA
ATGGATCAGATCTTGAACAAGGTAGGCTCGTACTGGTTAGGTAAGAAAGCGAACAAGCAGCTCGATTCCGTCGGTGACGA
TATCAACTCTTTGTCTACAAGCATCGAAGGAGGAACAAAATGGTTGGTGAACAAAATCAAAGGAAAAATGCAGAAGCCAT
TACCCGAGTTACTTAAGGAGTTTGGTTTGCCTGTGGGGATCTTTCCACGTGATGCAACCAACTACGAGTTCAATGAACAG
ACGAGGAAACTAACCGTCTTTATTCCATCAATCTGCGAAGTTGGCTACAAAGATTCATCAGTCTTGAGATTCACCACAAC
AGTTACCGGATTTCTAGAGAAAGGAAAACTAGCCGATGTTGAAGGGATGAAGACAAAAGTAATGATATGGGTTAAAGTCA
CAAGTATTTCTGCTGATTCTTCAAAGGTACATTTCACAGCAGGGATGAAGAAAATCAGAAGCCGTGATGCTTATGAGGTT
TTAAGAGATGGCGTTGAGATTGATAAATTCTAG