Details for Lyrate rockcress Locus 16036957

Position : sca3 ( 5`- 8874720 .. 8872756 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16036957

Protein [Map View]
MIGNAVIQVPSSLMPSSSMIACPRVSPNGVPYLPPKPRTRHLLVRAASNSDAAHGQPSSDEGKNPLTVVLDVPRNIWRQT
LKPLSDFGFGKRSVWEGGVGLFIVSGATLLALSWAWLRGFQMRSKFRKYQTVFELSHASGICTGTPVRIRGVTVGTIIRV
NPSLKNIEAVAEIEDDKIIIPKNSLVEVNQSGLLMETMIDIMPRNPIPEPSVGPLHPECGKEGLIVCDRQTIEGVQGVSL
DELVGIFTRIGREVEAIGVANTYSLAERAASVIEEARPLLKKIQAMAEDAQPLLSEFRDSGLLKEVECLTRSLTQASDDL
RKVNSSIMTPENTELIQKSIYTLVYTLKNVESISSDILGFTGDEATRKNLKLLIKSLSRLL*

DNA
ATGATTGGGAATGCGGTTATTCAAGTTCCATCATCACTAATGCCATCATCTTCCATGATTGCTTGTCCTCGAGTTTCACC
CAATGGGGTTCCTTATCTTCCACCGAAACCGAGAACTAGGCATTTACTGGTCAGAGCTGCATCCAATTCCGACGCTGCTC
ATGGTCAACCATCGTCTGATGAAGGGAAGAATCCGCTCACGGTTGTTTTGGATGTGCCCAGGAATATATGGAGACAGACT
TTAAAACCTTTGAGTGATTTTGGGTTTGGTAAGAGAAGTGTTTGGGAAGGTGGGGTTGGTTTGTTCATTGTCTCTGGAGC
TACGCTTCTTGCTCTTAGCTGGGCTTGGTTGCGAGGGTTTCAAATGCGGTCCAAGTTTAGGAAATATCAGACTGTGTTTG
AGCTTAGTCATGCATCAGGCATTTGCACGGGAACACCGGTTAGGATCCGTGGGGTTACTGTTGGTACGATTATCCGTGTT
AATCCTTCCTTGAAGAATATTGAAGCTGTTGCTGAGATAGAAGATGATAAGATTATTATCCCGAAGAATTCACTAGTTGA
GGTGAATCAGTCTGGTCTTCTAATGGAAACTATGATCGACATTATGCCTAGAAATCCGATACCAGAACCTTCAGTAGGAC
CTCTGCATCCTGAATGTGGTAAAGAAGGTCTGATCGTTTGTGATAGGCAGACGATAGAAGGAGTGCAAGGAGTTAGTTTA
GATGAATTAGTTGGAATTTTCACTCGTATTGGACGCGAAGTAGAGGCCATTGGTGTTGCCAATACGTATTCGCTTGCTGA
AAGAGCAGCTTCGGTTATTGAGGAAGCAAGGCCATTGCTCAAAAAGATTCAAGCCATGGCTGAAGATGCTCAACCTTTGC
TCTCTGAGTTTCGTGATAGCGGCTTGCTCAAGGAAGTTGAGTGTCTTACTCGAAGCCTTACCCAAGCTTCTGACGATTTG
AGAAAGGTTAATTCGTCAATTATGACACCTGAGAATACAGAACTCATACAGAAGTCAATCTACACTCTGGTTTATACTTT
GAAGAACGTCGAGAGTATAAGCTCAGATATTCTGGGGTTCACAGGCGATGAAGCCACAAGAAAAAACCTTAAACTACTCA
TCAAATCCCTAAGCAGGCTACTATGA