Details for Lyrate rockcress Locus 16036954

Position : sca3 ( 5`- 2106934 .. 2106614 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16036954

Protein [Map View]
MSPCRKKTKDDANFLEDVKDHIDEFMSASMDDHKNCFNKTIKKMFGLSKAVAEKQQTEAKGVESYLPLQTTVSD*

DNA
ATGTCTCCATGTCGAAAGAAGACAAAGGATGATGCCAATTTCCTTGAAGACGTCAAGGATCACATTGATGAATTCATGAG
TGCTTCCATGGATGATCACAAGAATTGTTTCAACAAGACCATAAAAAAGATGTTTGGGTTATCAAAGGCTGTTGCGGAGA
AGCAGCAAACTGAGGCTAAAGGAGTCGAGAGTTATTTGCCACTTCAGACAACAGTCTCGGACTAG