Details for Lyrate rockcress Locus 16036944

Position : sca3 ( 5`- 9366303 .. 9364270 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16036944

Protein [Map View]
MGVDLRQVVAGILTITMFVMLGQMLHRDYFDSLQEKAQGDAQDIEFEGSKVSVKDGLVGTVEGSKGLWMEDNTDLNPCWP
TLLSDEAVSSKGYVTFSLTNGPEYHISQISDAVMVAKHLGATLVLPDIRGSKPGDERNFEDIYDADKLIKSLENVVKVVK
QLPEEVSLRNMAIVKVPTRVTEDYIKEHIDPIFKSKGNIRVASYFPSVNLRKSSQDGETDPVACLAMFGSLELQPEVNAV
AESMVERLRTHSRKSGGRFIAVDLRIDILEKKNCHTTGVVGSKTCYNAQEIALFLRKLGFASDTTIYLTQPRWDSSLNIL
KDIFPKTFTKEAIMPASKRSKYLESESSEYENVIDFYISSRSDVFVPAISGLFYANTVGKRIALGKPQVLVPAEISETSG
RATDFISPYISKKNHLAYSCFC*

DNA
ATGGGTGTTGATTTGAGGCAAGTAGTGGCTGGTATTCTCACCATTACCATGTTTGTCATGCTTGGACAGATGCTTCATAG
AGATTACTTTGATTCTCTTCAGGAGAAAGCTCAGGGAGATGCACAAGATATTGAATTTGAAGGATCTAAAGTCTCTGTGA
AAGATGGTCTTGTCGGAACCGTTGAAGGCAGTAAGGGACTTTGGATGGAGGATAACACTGATCTTAATCCTTGTTGGCCA
ACATTACTATCAGATGAAGCGGTATCATCGAAAGGGTATGTTACATTCTCACTAACCAATGGTCCTGAGTACCATATCTC
TCAGATCTCTGATGCTGTAATGGTGGCAAAGCATCTTGGAGCAACTCTAGTACTTCCTGATATAAGAGGAAGCAAACCTG
GTGATGAAAGGAATTTTGAAGATATCTATGATGCGGATAAACTAATTAAAAGCTTGGAAAATGTTGTTAAAGTTGTGAAA
CAATTGCCTGAAGAAGTTTCTCTTAGGAACATGGCCATTGTGAAGGTCCCTACCAGAGTTACAGAAGATTACATTAAGGA
GCACATTGATCCCATCTTCAAATCGAAAGGAAACATTCGAGTCGCATCATACTTTCCTTCTGTAAACTTGAGGAAATCCT
CACAAGATGGCGAAACTGATCCAGTAGCATGTTTAGCAATGTTTGGGTCATTGGAGCTGCAACCCGAAGTGAATGCAGTG
GCTGAATCAATGGTTGAGCGGTTGAGGACTCATAGCCGGAAATCAGGTGGCCGTTTCATAGCAGTAGACCTTAGAATCGA
CATACTTGAGAAGAAAAATTGTCATACAACGGGTGTAGTAGGCTCCAAGACTTGTTACAACGCGCAAGAGATTGCTTTGT
TCTTGAGGAAGCTTGGGTTTGCCAGCGACACAACTATCTATCTGACTCAGCCAAGATGGGACAGTAGCCTCAATATCCTT
AAGGATATCTTCCCGAAAACATTCACAAAGGAGGCAATAATGCCGGCAAGTAAGAGGTCAAAGTACCTTGAATCAGAGAG
TTCTGAGTACGAAAATGTTATCGACTTTTACATAAGCTCAAGAAGCGATGTCTTTGTTCCAGCCATATCCGGTCTGTTTT
ACGCAAACACCGTTGGCAAAAGGATAGCTTTAGGTAAGCCTCAAGTGCTAGTTCCAGCAGAAATCTCAGAGACATCTGGC
CGTGCTACAGATTTCATCTCTCCGTACATTTCAAAGAAGAATCACTTGGCTTATTCATGCTTTTGCTGA