Details for Lyrate rockcress Locus 16036927

Position : sca3 ( 5`- 7844664 .. 7842094 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16036927

Protein [Map View]
MEITDEWGRKLCISSSPEESIGPFFSNPSDSQLLFSSPSLSPPILSTIPHFSPARFLSVSGVPPSDSSAIHSSFNILNPH
DDTARVLSYNRLQFLPFPSKNSVLVFFPTGTNLDQIGFLLLSTGDSGGLQVTGSDEGDVFVATERLFYRILKILVQPVSD
FGAYKCSSSGELGYVLVYCLYSIHWYCVKYDESQGKPVLRNLGSKQFKRFMIVSASWSPHVTGECLLLLDNGEVFVFDLN
QRHCRLRGCKLKVSWESQGKSVNKSWLGCEFGWRVGIYIVARSDAVFAITRSSENCSVRCLLEVETLNMAGTEVFVGFAK
AGSDGFRFILASQSYVFLCDPRSGVPLLKWQHDVEKPCFMDVYSLSELGVRTVESNTSCVIIGSFWNAQSQMFCYGPSPS
VVKDPSSLYVWELPHNLLLPVGKCLCGDCVFREVMMKESLPEWIDWQKKSVLVLGFGVLNKYLPLGSSDQSSGFTLIRLT
SSGKLEAVKFRASRLKSLEVVAHKDSACKSDEVNLLYLPDDEEYKFPSRYEYLELNYLSSHAKGMLAGFLDTKMRTKSSD
LQKSKSFSLIWHEELCKKLKICGFGRDRSSSSITAVFENIDSPTSVFDIALRETWSSLPIEILLLAFSNYSEFADVLVDK
KKPSLEFLVVPEFPQLPPFVLRKPSSRSNKWSKKEQPGVELVGPVLPLPVLITLHEFRNGCLNSEQEFSPEAELSNRCNQ
ISKVTRELANSGRDETTISLDDDLDDEMWLNSDSQKEKKTFIAYRPITKTADSDRLQQEVTTFVSRMRRCKEGDDNVGGR
TGLELFGELSPVEICFENREVNFDTKALLTSKTFLSQWQHRSSSYQEFLSQYHLTK*

DNA
ATGGAGATTACCGATGAATGGGGACGCAAACTCTGCATCTCCTCCTCTCCCGAAGAATCCATTGGTCCTTTCTTCTCGAA
CCCGTCAGATTCTCAGCTTCTCTTCTCTTCTCCCTCACTCTCTCCTCCGATTCTCTCTACTATCCCTCACTTCTCTCCCG
CGCGTTTTCTCTCCGTCTCCGGCGTCCCTCCGTCGGATTCTTCCGCAATCCATTCCTCTTTCAATATTCTCAATCCGCAC
GATGATACCGCCAGGGTTCTCTCCTACAATCGCCTCCAGTTTCTACCTTTCCCCAGTAAAAATTCAGTCTTGGTGTTTTT
CCCCACAGGGACTAATCTTGATCAAATTGGGTTCTTGCTGCTTTCTACCGGAGATTCCGGTGGTTTACAAGTCACGGGTT
CAGACGAAGGTGACGTCTTTGTGGCAACAGAGAGATTATTTTATCGAATTTTGAAGATTTTGGTGCAACCTGTTAGTGAT
TTTGGAGCGTATAAGTGTTCTTCTTCTGGCGAATTGGGATACGTTTTGGTTTATTGTTTGTATTCGATTCATTGGTACTG
TGTCAAGTATGATGAATCTCAAGGTAAGCCGGTTTTGAGAAACTTGGGGTCTAAGCAGTTTAAGAGGTTTATGATTGTAA
GCGCTTCTTGGAGCCCTCATGTTACTGGAGAGTGTCTACTCTTGTTAGACAACGGTGAGGTCTTTGTGTTTGATTTGAAT
CAGAGACATTGTAGACTTAGAGGTTGCAAACTGAAAGTTTCTTGGGAGAGTCAAGGGAAATCAGTGAATAAGAGTTGGTT
AGGGTGTGAATTTGGTTGGAGAGTTGGGATTTATATCGTTGCTCGGTCTGATGCAGTCTTTGCTATTACCAGAAGCTCTG
AGAATTGCAGTGTGAGATGTTTATTGGAAGTTGAGACTCTGAATATGGCTGGAACAGAAGTGTTTGTTGGGTTTGCAAAG
GCGGGTAGTGACGGTTTTCGGTTTATTCTTGCTTCCCAGAGCTATGTATTTCTCTGTGATCCGAGATCAGGAGTACCCTT
GTTGAAATGGCAGCATGATGTTGAGAAGCCTTGCTTTATGGATGTTTATAGCTTGTCTGAACTCGGAGTTAGGACCGTTG
AATCAAATACTTCTTGCGTCATAATTGGGTCGTTTTGGAATGCACAATCTCAAATGTTCTGTTATGGACCTTCTCCTTCT
GTTGTGAAGGATCCTTCTTCCTTGTATGTATGGGAGCTTCCACACAATCTACTCTTACCTGTTGGAAAGTGTCTATGCGG
AGATTGTGTATTTAGAGAAGTAATGATGAAGGAGTCTCTTCCCGAGTGGATCGATTGGCAGAAAAAGAGTGTTCTTGTTC
TCGGTTTTGGTGTTTTAAACAAGTACCTTCCACTTGGGTCATCAGATCAATCTTCCGGGTTTACTTTGATTCGGTTAACA
TCCTCCGGTAAGCTTGAAGCAGTCAAGTTTCGAGCTTCTCGTTTAAAAAGCTTAGAAGTAGTAGCTCACAAAGATTCGGC
CTGCAAATCCGACGAGGTGAACTTACTGTACCTCCCTGATGACGAGGAATACAAATTCCCAAGTCGATATGAATATCTCG
AACTCAACTATCTCTCTTCTCACGCAAAAGGGATGCTCGCTGGGTTTTTAGATACAAAGATGAGGACAAAATCATCGGAT
TTGCAGAAGAGTAAATCTTTCAGCTTAATCTGGCACGAGGAGTTATGTAAGAAGTTGAAGATTTGCGGATTTGGTAGAGA
CAGATCTTCTTCTAGCATAACCGCAGTCTTTGAGAATATCGATTCACCGACAAGCGTTTTCGACATTGCATTGAGAGAAA
CCTGGTCAAGCTTACCTATAGAGATTTTGTTGCTTGCATTCTCCAACTACTCTGAGTTTGCAGATGTTCTGGTAGACAAG
AAAAAACCATCTCTCGAGTTCTTAGTTGTTCCAGAATTCCCACAGTTACCACCTTTCGTGTTAAGGAAACCTTCAAGCCG
GAGTAACAAATGGTCAAAGAAGGAGCAACCCGGTGTTGAGCTTGTTGGTCCTGTTCTTCCACTTCCAGTTCTCATCACAC
TCCATGAGTTCCGTAACGGATGTCTCAATTCAGAACAAGAGTTCTCGCCCGAAGCAGAGTTATCTAACCGATGCAATCAG
ATCTCCAAAGTAACCCGCGAGCTTGCAAACTCAGGTCGAGACGAGACAACCATTTCACTTGACGATGACCTAGACGATGA
AATGTGGCTCAACAGTGATTCACAGAAGGAGAAAAAGACGTTCATTGCTTATCGTCCGATCACAAAGACAGCTGATTCAG
ACAGACTACAGCAAGAAGTCACTACGTTTGTCTCCAGAATGCGTCGTTGTAAAGAAGGTGATGATAATGTTGGAGGAAGA
ACAGGGCTTGAACTGTTTGGTGAGTTGTCTCCGGTCGAGATTTGCTTCGAAAATCGGGAAGTGAATTTCGACACTAAAGC
TTTGCTAACTTCCAAGACGTTTCTCTCTCAATGGCAGCATCGATCATCTTCATATCAAGAGTTTCTTTCTCAGTACCATC
TAACAAAATGA