Details for Lyrate rockcress Locus 16036908

Position : sca1 ( 5`- 7779374 .. 7778246 -3` )
Annotation : [B2G] 60s ribosomal protein l6
External links : CoGe
PGDD synteny : 16036908

Protein [Map View]
MPAAKQRTPKVNRNPDLIRGVGKYSRSQMYHKRGLWAIKAKNGGVFPRHDAKSKVDAPVEKPAKFYPAEDVKKPLVNRRK
PKPTKLKSSITPGTVLIILAGRFKGKRVVFLKQLSSGLLLVTGPFKINGVPLRRVNQAYVIGTSTKIDISGVNTEKFDDK
YFGKVAEKKKKKGEGEFFESEKEEKKEIPQEKKEDQKTVDAALIKSIEAVPELKVYLGARFSLSQGMKPHELVF*

DNA
ATGCCGGCGGCGAAGCAGAGGACTCCGAAAGTTAACCGTAACCCTGACCTAATCAGGGGGGTCGGCAAATACTCTAGGTC
TCAGATGTACCACAAGAGAGGTTTGTGGGCAATCAAGGCCAAAAACGGCGGCGTTTTCCCTCGTCACGATGCTAAGTCTA
AGGTCGATGCTCCGGTGGAGAAGCCTGCCAAGTTTTATCCAGCGGAAGACGTTAAGAAGCCGCTCGTTAACAGACGCAAG
CCTAAGCCTACCAAGCTAAAATCAAGCATCACTCCAGGAACTGTGTTGATCATTCTTGCTGGTAGATTCAAGGGAAAGAG
AGTTGTCTTCCTCAAGCAACTTTCTTCTGGTTTGCTTCTTGTCACAGGACCATTCAAGATCAATGGTGTACCATTGAGAC
GTGTTAACCAAGCCTATGTGATTGGAACCTCCACAAAGATTGACATTTCTGGAGTCAACACTGAGAAATTCGATGACAAG
TATTTTGGAAAGGTTGCTGAGAAGAAGAAGAAGAAAGGAGAAGGCGAATTCTTCGAATCTGAGAAAGAGGAGAAGAAAGA
GATCCCACAGGAGAAGAAGGAAGACCAGAAAACCGTTGACGCTGCTCTGATCAAATCCATCGAGGCAGTCCCAGAGCTCA
AGGTTTACCTTGGAGCCAGGTTCTCATTGAGTCAAGGAATGAAACCACATGAGCTTGTTTTCTAG