Details for Lyrate rockcress Locus 16036896

Position : sca3 ( 5`- 9859887 .. 9863362 -3` )
Annotation : [B2G] zinc finger family protein
External links : CoGe
PGDD synteny : 16036896

Protein [Map View]
MVRKHGWQLPAHTLQVIAITVFCLLVVAFYAFFAPFVGGRIWEYVLIGVYSPVAILVLVLYVRCTAINPADPRIMSIFDT
GVNRDDMVGALSRNFDEAGSQLQASPSVVSRSSTVAGNSSVKGSVGDSQRVESVRRRSCYNPLAIFCYVFVLEDCRKQEG
AAEQEGNSEEALFCTLCNSEVRKFSKHCRSCDKCVDCFDHHCKWLNNCVGRKNYVTFVSLMSASLLWLVIEAAVGIAVIV
RVFVNKQSMETEIVNRLGNSFSRAPLAAVVGLCTAVAILACFPLGELLFFHMLLIKKGITTYEYVVAMRAMSEAPDGASV
DEEIQNVLYSPTGSATTGFSGGSSLGLPYKGVWCTPPRVFDNQDEVIPHLDPRMVPSTVDPDAPGSEKGTKALKRPVKRN
AWKLAKLDPNEAARAAARARASSSVLRPIDNRHLPDSELSSIGTVSIISSVSTDANVAANKEIRNNDLRSSLSRNSFAPS
QGSRDEYDTGSHGMSNLSSPSHVHESVTLAPLPQNPTIVGNRFTATNHHMHSTFDDKVLHRGNDADPLFLSAPATSHLRD
VRKTSVVWDPEAGRYVSAPVTTTSEVCNRLLNPSSQTANSQNPRPILPAHDSSSGSSTLRDPLPMHQAERRLTYTGDSIF
YGGPLINIPTRDTPRSGRGLVREVQDRLASTVHRDARFRKDSTSNQLPVFAPGGLGTNSGSNIK*

DNA
ATGGTGAGGAAACACGGTTGGCAACTTCCTGCTCACACTCTTCAGGTGATTGCAATTACGGTGTTTTGCTTGTTGGTGGT
CGCTTTCTATGCTTTCTTCGCTCCTTTTGTTGGAGGTCGTATTTGGGAATACGTTTTGATCGGTGTTTACTCTCCTGTGG
CTATTCTTGTGCTTGTTTTGTATGTTCGGTGTACTGCAATCAATCCTGCGGATCCAAGAATCATGTCGATATTTGATACA
GGCGTGAACAGAGATGATATGGTTGGTGCCTTATCGAGGAATTTTGATGAAGCTGGTAGTCAGTTGCAGGCTTCTCCTTC
AGTTGTCAGCAGGAGTTCTACCGTAGCAGGAAACTCTAGTGTGAAAGGTTCTGTAGGAGATTCTCAAAGAGTGGAATCTG
TGAGAAGAAGATCTTGCTATAATCCTCTGGCTATCTTCTGTTACGTGTTTGTTTTGGAAGACTGCCGAAAACAGGAAGGG
GCGGCGGAACAAGAAGGAAACAGCGAAGAAGCTCTGTTTTGCACATTGTGCAATTCTGAGGTACGCAAGTTCAGCAAGCA
TTGTCGGAGTTGTGATAAATGTGTTGATTGTTTTGATCACCATTGCAAGTGGCTTAACAATTGCGTCGGTCGTAAAAACT
ACGTGACTTTTGTCTCTCTGATGAGTGCCAGTCTTCTCTGGCTCGTTATTGAAGCAGCAGTTGGAATTGCAGTTATAGTG
CGTGTATTTGTTAATAAGCAGAGCATGGAAACTGAAATTGTCAATAGACTTGGAAATAGTTTCTCTCGTGCACCTTTAGC
GGCAGTTGTCGGTCTTTGCACTGCTGTTGCCATTTTGGCATGTTTTCCACTGGGTGAACTTCTCTTTTTCCACATGCTTC
TCATTAAAAAGGGAATTACAACATATGAGTATGTTGTGGCAATGAGAGCAATGAGCGAGGCGCCAGATGGAGCATCTGTT
GACGAGGAAATTCAGAATGTGCTCTATTCTCCCACTGGATCTGCTACAACCGGCTTTAGTGGTGGAAGCTCTCTCGGTCT
ACCATACAAGGGGGTCTGGTGCACTCCACCTAGAGTGTTTGATAATCAGGATGAAGTCATTCCCCATTTAGACCCTCGCA
TGGTCCCGTCGACCGTAGACCCAGATGCCCCTGGATCAGAGAAAGGCACCAAGGCTCTGAAAAGACCTGTCAAACGTAAT
GCATGGAAGCTTGCAAAGTTGGATCCAAATGAAGCTGCAAGGGCAGCTGCCAGAGCCAGAGCGTCATCATCTGTCCTAAG
ACCGATAGATAATCGCCATTTACCTGATAGTGAACTTAGTTCAATTGGCACAGTTAGTATCATCAGTAGTGTAAGCACAG
ATGCAAATGTGGCTGCAAATAAAGAGATAAGGAACAATGATCTAAGGTCATCTCTTTCTAGAAACTCCTTTGCTCCAAGC
CAAGGTAGCCGGGATGAGTATGACACAGGGAGCCATGGTATGAGCAATCTTAGCAGTCCAAGCCATGTTCACGAGTCTGT
CACACTTGCTCCGCTCCCTCAGAATCCTACAATAGTCGGCAATCGCTTCACTGCAACAAACCACCACATGCACTCAACCT
TTGATGATAAGGTGCTGCACAGAGGAAATGACGCGGATCCGCTATTTCTCTCTGCTCCTGCAACTTCTCATCTGAGGGAT
GTGAGAAAGACATCAGTTGTTTGGGATCCAGAAGCTGGGAGATATGTATCAGCTCCTGTAACGACAACATCTGAGGTCTG
CAACAGATTGCTAAATCCTAGCTCACAAACAGCCAACTCTCAGAATCCAAGACCCATTCTTCCAGCTCATGATTCTTCTT
CTGGATCATCAACACTAAGGGATCCTCTTCCTATGCACCAAGCGGAGAGAAGACTGACATATACTGGTGACTCTATCTTC
TATGGAGGCCCTCTGATTAATATTCCGACTAGAGATACCCCGAGAAGTGGCAGGGGCTTGGTAAGAGAGGTACAAGACAG
ATTGGCGTCAACAGTTCATCGGGATGCAAGATTCAGAAAGGATTCAACCTCAAACCAGCTTCCGGTGTTTGCCCCTGGAG
GTCTTGGGACAAACTCCGGTTCTAACATCAAGTAG