Details for Lyrate rockcress Locus 16036883

Position : sca3 ( 5`- 3311168 .. 3313050 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_478135 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16036883

Protein [Map View]
MSLGQENVEPVEVSGSHACLYELLCSETPKWTPLKDLQTSSSDPRDRLEKLLKQPGNKYCADCGSPEPKWVSLSLGVFIC
IKCSGVHRSLGVHISKVLSVKLDEWTDDQVDMLVGYGGNTAVNQRFEACNIDQSKKPKPDSTNEERNDFIRKKYEQHQFM
DPKDGALCPYQQPSRTNTSPPSLCSASHRSTKNRIGHAFRNSWGRRESDHKGPKKSNSMAGMVEFVGLIKVNVVKGTNLA
VRDVMTSDPYVILALGQQSVKTRVIKNNLNPVWNETLMLSIPEPMPPLKVLVYDKDTFSTDDFMGEAEIDIQPLVSAAKA
YETSSIKEPMQLGSWVASKENTLVSDGIISLEEGKVKQDISLRLQNVERGVLEIQLECLPLTQ*

DNA
ATGTCTCTAGGCCAAGAAAATGTCGAACCTGTTGAAGTTTCAGGGTCGCATGCTTGCTTATATGAACTTTTATGTTCAGA
GACACCCAAATGGACTCCTCTTAAGGATTTGCAAACATCTTCTTCTGATCCCAGAGATCGGTTGGAGAAGTTGCTGAAGC
AACCTGGGAATAAATATTGTGCTGACTGTGGCTCTCCTGAACCAAAATGGGTATCGTTGAGTCTCGGTGTATTTATCTGC
ATTAAGTGTTCTGGTGTACACAGAAGTCTTGGAGTTCATATATCAAAGGTTCTATCAGTAAAGCTAGACGAGTGGACAGA
TGATCAAGTTGACATGCTTGTAGGGTACGGTGGAAACACGGCAGTGAACCAGAGATTCGAGGCTTGCAACATCGACCAGT
CAAAGAAACCAAAACCAGATTCTACTAATGAGGAACGCAATGATTTCATCAGAAAAAAATATGAGCAGCACCAGTTTATG
GATCCAAAGGATGGTGCTTTGTGCCCTTATCAGCAGCCTAGCAGAACAAATACTTCACCACCGTCTTTATGTTCTGCAAG
CCACCGTTCTACAAAAAACCGTATTGGTCATGCATTTAGGAATAGCTGGGGAAGAAGAGAATCTGATCACAAAGGACCAA
AGAAGAGCAATTCCATGGCAGGTATGGTTGAGTTTGTGGGATTGATTAAGGTTAACGTGGTAAAAGGAACCAACCTTGCG
GTTCGAGACGTGATGACCAGCGATCCTTATGTTATCCTTGCTCTTGGACAGCAATCGGTAAAAACACGGGTGATAAAGAA
CAACTTGAATCCGGTGTGGAATGAGACGCTAATGCTTTCGATACCCGAGCCCATGCCTCCTCTCAAAGTGCTAGTGTACG
ACAAGGATACATTCTCGACAGATGATTTCATGGGAGAGGCAGAGATAGACATACAACCATTGGTGAGTGCAGCGAAAGCA
TATGAGACATCGAGCATAAAGGAACCGATGCAGCTGGGAAGTTGGGTGGCGAGCAAAGAGAACACATTGGTGAGTGATGG
CATAATATCACTTGAAGAAGGGAAAGTGAAACAAGACATATCACTTAGGCTTCAAAATGTTGAAAGAGGTGTTCTTGAGA
TCCAGCTTGAATGTCTTCCTCTCACTCAATGA