Details for Lyrate rockcress Locus 16036881

Position : sca3 ( 5`- 3168589 .. 3167477 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16036881

Protein [Map View]
MDSAREVSDGRLTVEGFSVAARTFADRWKIHNQAFPPWSWIPLINRTLLVSNKQEEGYLSLEKIIILSSLDEIPEDESLN
VATDCSEKEESIDHTILVPTLENEPHYYDFHIVYSASYKVPVLYFRGYCSGGQPLALDVIKKDLPSCSVSLLLESKWTFI
TQEEHPYLNRPWFKLHPCGTEEWIKLLSQSSSSSGCHMPVELYLVSWFSVVGQVVGLRTPLQMLN*

DNA
ATGGATTCAGCTCGAGAGGTCAGCGATGGTAGACTCACCGTTGAGGGTTTCTCTGTAGCTGCTCGAACTTTTGCCGATAG
GTGGAAGATACATAACCAAGCGTTCCCTCCATGGTCCTGGATTCCTCTGATCAATCGAACTCTACTTGTTTCAAATAAGC
AGGAGGAAGGTTACTTGTCGCTAGAGAAGATCATCATTCTCAGTTCACTTGATGAAATTCCAGAGGATGAATCTTTAAAT
GTCGCAACTGATTGCTCGGAAAAAGAAGAGTCAATTGATCACACAATCTTGGTCCCAACCCTGGAAAATGAACCACACTA
CTATGATTTCCATATAGTTTACAGTGCTTCATACAAGGTTCCTGTGCTTTATTTTCGTGGATACTGCAGCGGTGGACAAC
CCCTTGCTTTGGATGTCATAAAAAAAGATCTGCCCTCATGCTCTGTTAGTCTTTTGCTGGAATCTAAGTGGACATTTATA
ACTCAGGAGGAGCACCCATATTTAAACAGGCCATGGTTCAAGCTACATCCCTGTGGGACTGAGGAATGGATCAAGCTGCT
CTCTCAAAGTAGCAGCTCTTCTGGATGTCATATGCCAGTTGAGTTGTACTTGGTCTCATGGTTCTCTGTTGTCGGGCAGG
TGGTTGGTCTTAGGACCCCTCTTCAGATGCTGAATTAG