Details for Lyrate rockcress Locus 16036877

Position : sca3 ( 5`- 3571552 .. 3571121 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16036877

Protein [Map View]
MSRRACKRVSFNPNPEATDEPIFPKHDGLSSSHHSRRRVVLFGILSFGLRSSPAARKLIHRIGARFTKTLRFISFRRNAT
DRKTSSFLLPSSSSSSSSTIYMKRSKSVSETESHRAEAIEDCIEFLNSSFSLSRSNSVSTWSS*

DNA
ATGTCACGAAGAGCATGCAAAAGAGTAAGCTTTAATCCGAACCCAGAAGCCACAGACGAACCCATATTCCCAAAACACGA
CGGTTTAAGCTCGTCACATCACAGCCGGAGAAGGGTGGTTCTCTTCGGAATTCTCAGTTTTGGTCTAAGGAGCTCGCCGG
CCGCCAGGAAATTGATCCACCGTATTGGAGCAAGATTCACCAAAACGCTGCGTTTTATTTCCTTCAGAAGAAATGCTACT
GATAGAAAAACGTCATCGTTTTTGTTGCCTTCGTCATCGTCTTCTTCTTCTTCGACTATTTATATGAAGAGGTCAAAGTC
TGTAAGCGAGACAGAGTCTCACCGAGCAGAAGCTATTGAAGATTGCATTGAGTTCTTGAACTCTTCTTTTTCTCTTTCGA
GATCAAACTCAGTCTCAACGTGGTCTTCTTGA