Details for Lyrate rockcress Locus 16036861

Position : sca3 ( 5`- 3879721 .. 3878044 -3` )
Annotation : [B2G] clathrin adaptor complex small chain family protein
External links : CoGe
PGDD synteny : 16036861

Protein [Map View]
MSHDSCPLVKNILLLDSEGKRVAVKYYSDDWQTNAAKLSFEKYVFSKTSKTNARTEAEITLLDNNIIVYKFAQDLHFFVT
GGENENELILASVLQGFFDAVALLLRNNVEKMEALENLDLIFLCLDEMVDQGVVLETDPNVIAGKVAMQSTEASGSLSEQ
TLTQALATAREHLARSLLT*

DNA
ATGTCTCATGATTCTTGTCCCTTGGTAAAGAACATTCTTCTTCTAGACTCTGAAGGAAAGCGTGTGGCTGTCAAGTATTA
CTCGGATGACTGGCAAACTAATGCCGCCAAGTTAAGTTTTGAGAAATACGTATTCTCAAAGACCTCTAAGACCAATGCTC
GCACAGAAGCTGAGATCACACTGTTGGACAACAATATTATTGTCTATAAGTTTGCCCAGGACCTTCACTTCTTTGTTACT
GGAGGTGAAAATGAAAACGAGCTCATTTTAGCTTCTGTTCTTCAAGGCTTTTTTGATGCTGTTGCACTTCTCTTGAGGAA
CAATGTGGAAAAGATGGAAGCCCTCGAGAACTTGGATCTCATCTTTCTATGCCTTGATGAAATGGTCGATCAGGGGGTGG
TTCTTGAAACGGATCCAAACGTCATTGCGGGGAAAGTAGCAATGCAGAGCACAGAAGCTAGTGGTTCACTCTCTGAACAG
ACACTGACTCAAGCGCTAGCAACAGCTCGGGAGCATCTGGCGAGAAGTCTGCTTACATGA