Details for Lyrate rockcress Locus 16036786

Position : sca3 ( 5`- 5868674 .. 5869569 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16036786

Protein [Map View]
MANMNALQQMIFPDENAPIHRKKSVTAASVKSKGTVLGQKKPGGARKALNDITNKSGIHAKASSKNKQIASAAAAKDEID
IAGERFLHDHSKCIKEQQSLWDDHYSSDLILLHHESSIKEKHLNYDIEKMDAKNNLTYEEPEEMASPKLSDWLKNSTPWR
SPIRHGSMMPSTPLAWRFDSSEFTLKEHSDDLF*

DNA
ATGGCGAACATGAACGCTCTTCAACAGATGATCTTCCCAGACGAGAACGCTCCGATTCATCGCAAAAAGTCTGTTACTGC
TGCTTCTGTGAAATCCAAAGGAACTGTACTTGGTCAGAAGAAACCTGGAGGAGCTCGTAAAGCTCTGAATGATATTACAA
ACAAGTCTGGGATTCATGCGAAAGCTTCTTCAAAGAATAAGCAAATTGCTTCTGCTGCTGCTGCAAAAGATGAGATTGAC
ATAGCTGGGGAAAGGTTCTTACATGATCACAGCAAATGCATCAAAGAGCAGCAAAGTCTCTGGGATGATCACTACTCGTC
TGATCTCATTCTACTTCATCATGAATCCAGCATCAAGGAGAAGCATCTCAATTATGACATTGAAAAGATGGATGCTAAGA
ACAATCTGACTTACGAAGAACCAGAAGAGATGGCATCACCAAAGTTGTCTGATTGGCTGAAGAACTCGACTCCATGGCGC
TCTCCAATCCGTCATGGCTCTATGATGCCTTCCACTCCTCTGGCTTGGCGGTTCGATTCAAGTGAATTCACACTTAAAGA
ACACTCTGACGACCTCTTCTGA