Details for Lyrate rockcress Locus 16036774

Position : sca3 ( 5`- 2780458 .. 2782021 -3` )
Annotation : [B2G] peptidyl-prolyl cis-trans isomerase cyclophilin-type family protein
External links : CoGe
PGDD synteny : 16036774

Protein [Map View]
MAKIKPQALLNQSKKKKGPSRISISTIFVCNLVVAVVILSLVTTYRHWSQRSRNTIEHETQSQRFEDTNTASEQKTYDLP
GYADINTSKGLITVELFKEGSPEVVDKFLDLCQKDHFKGMPFHRVIKNYLVQAGHSPSSIPVEEWTAKGKLRGRLHIGPK
HEAFMLGTPKNKGNNKDFELLITTAPIPDLNDQLIVFGRVLKGEDVVQEIEEVDTDEHYQPKSPIGITGVVLKRGI*

DNA
ATGGCGAAGATAAAACCTCAGGCTCTTCTAAATCAAAGCAAGAAGAAGAAGGGTCCAAGTCGCATAAGTATTTCCACTAT
TTTCGTCTGTAATCTTGTTGTTGCTGTAGTCATACTATCCTTGGTCACTACTTATCGCCATTGGTCCCAAAGGTCAAGAA
ACACAATTGAACATGAAACTCAGAGTCAGAGATTTGAGGACACAAATACTGCATCAGAGCAAAAAACTTACGACCTTCCT
GGTTATGCTGATATAAACACATCAAAAGGACTTATAACTGTCGAACTCTTCAAAGAAGGTTCCCCTGAAGTTGTGGACAA
GTTTCTAGATCTATGTCAAAAAGATCACTTCAAGGGAATGCCGTTTCATCGGGTTATAAAGAACTACTTGGTACAAGCTG
GTCACTCACCGAGCTCTATACCTGTAGAAGAATGGACAGCTAAAGGAAAGCTCCGAGGTCGCCTTCACATAGGCCCAAAA
CATGAGGCATTCATGTTGGGAACACCAAAAAACAAAGGGAACAACAAGGATTTTGAGCTTCTAATCACAACGGCGCCAAT
CCCGGATCTGAATGATCAGCTTATAGTGTTTGGAAGAGTCCTAAAGGGAGAGGATGTAGTACAGGAGATCGAAGAAGTGG
ATACGGATGAGCATTACCAACCGAAATCGCCAATAGGGATCACTGGTGTTGTACTGAAACGAGGGATATGA