Details for Lyrate rockcress Locus 16036770

Position : sca3 ( 5`- 11927309 .. 11925232 -3` )
Annotation : [B2G] aaa-type atpase family protein
External links : CoGe
PGDD synteny : 16036770

Protein [Map View]
MNRQNGGGQRLRSARPTTIHDCALSGDLIALQRLLKDNPSLLNERNPVMYHTPLHVSAGNGNVDIVKYLLAWTGSEKVEL
EAMNTYGETPLHMAAKNGCNEAAKLLLERGAFIEAKASCGKVGSFGLIWFWLMQNGMTPLHLAVWYSITAKDISTVKTLL
DHNADCSAKDNEGMTPLDHLPQGQGSEKLRELLRWFLQEQRKRSALEQCGKTKAKMELLEDELSNIVGLSELKTQLRKWA
KGMLLDERRRALGLNIGTRRPPHMAFLGNPGTGKTMVARVLGKLLNTVGILPTDKVTEVQRTDLVGEFVGHTGPKTRRKI
QEAEGGILFVDEAYRLIPMQKADDKDYGLEALEEIMSVMDTGKIVVIFAGYSEPMKRVIASNEGFCRRVTKFFNFSDFSA
KELAQILHIKMNNQGEDTLFYGFRLHESCTLQEIASLIEAETTEKQRKEMNGGLVDTLLVNARENLDLRLSFECVDTEEI
CTIKLEDLEAGLRVFSQ*

DNA
ATGAACCGACAAAACGGTGGAGGACAGCGGCTGAGATCCGCTAGACCCACCACAATTCACGATTGTGCTCTCTCCGGTGA
TCTTATTGCTTTGCAGAGACTTCTTAAAGACAATCCTTCTCTTCTCAATGAACGCAATCCCGTCATGTATCACACGCCTC
TTCATGTTTCTGCTGGTAATGGTAATGTTGATATAGTTAAGTATCTTCTTGCTTGGACTGGATCTGAGAAAGTTGAGTTA
GAAGCAATGAATACTTATGGTGAGACTCCATTGCATATGGCAGCAAAGAACGGTTGCAACGAAGCTGCGAAGCTACTCCT
TGAGCGTGGTGCTTTTATCGAAGCTAAAGCCAGCTGTGGAAAGGTGGGAAGTTTTGGACTGATTTGGTTTTGGCTTATGC
AGAACGGTATGACACCATTGCACCTTGCGGTATGGTACTCAATTACTGCAAAAGACATCTCAACTGTTAAGACACTGCTT
GATCATAACGCAGATTGCAGCGCAAAAGATAATGAAGGGATGACTCCTTTGGACCATCTGCCTCAAGGACAAGGCAGTGA
GAAGTTACGGGAATTGTTGCGCTGGTTTCTCCAAGAACAGAGGAAAAGAAGCGCGCTTGAGCAATGCGGTAAGACAAAAG
CCAAGATGGAACTACTTGAGGACGAGTTGTCAAATATTGTTGGATTAAGTGAGCTGAAGACACAACTGAGGAAATGGGCA
AAAGGAATGCTTTTAGATGAAAGGCGAAGGGCTCTTGGGCTGAACATTGGAACCCGAAGACCTCCGCATATGGCATTTCT
TGGAAATCCTGGGACAGGTAAAACCATGGTAGCTCGAGTTCTTGGGAAGCTGCTTAACACGGTTGGAATTTTACCAACTG
ATAAGGTAACAGAAGTACAGCGTACAGACTTGGTTGGTGAGTTTGTTGGCCATACAGGACCAAAGACCAGGAGAAAGATC
CAAGAAGCTGAGGGAGGAATTCTGTTTGTGGATGAAGCATACAGATTGATCCCGATGCAAAAGGCGGACGACAAGGACTA
CGGTCTAGAAGCTCTGGAAGAAATCATGTCGGTCATGGACACAGGGAAAATCGTGGTGATATTTGCGGGATACAGTGAGC
CCATGAAGCGTGTGATTGCATCAAACGAAGGGTTTTGCAGAAGGGTCACAAAGTTTTTCAATTTCAGCGACTTCAGTGCT
AAGGAACTGGCGCAGATACTACACATCAAGATGAACAACCAAGGAGAGGACACTCTGTTCTACGGTTTCAGATTGCATGA
GTCCTGCACTCTGCAGGAGATAGCGTCATTGATAGAGGCAGAAACAACCGAGAAGCAGAGAAAGGAGATGAACGGAGGAT
TGGTGGACACGTTACTTGTTAACGCGAGGGAGAATCTTGATCTCCGACTTAGCTTTGAATGTGTTGACACTGAAGAGATT
TGTACAATCAAGTTGGAAGATCTAGAGGCTGGGCTTCGAGTTTTCTCGCAGTGA