Details for Lyrate rockcress Locus 16036759

Position : sca2 ( 5`- 16488992 .. 16489821 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16036759

Protein [Map View]
MILSKRPHLMIRKLSEMLVPRSRSAAIKPEEYTASPRSPLDLNFPSPVNSKRFGSGGVGLGIVAALEETSNGINRHDPVR
YSGRFRCPEIDLSDEEEYTYVTSPNGPTKVYYNDDGFKLCENDYRRVHKPMVIADEPPVIKRQSFGDPTEFLSSCCLCKK
KLQGKDIYMYKGEMGFCSAECRSVQIMNDERKEQCKTQVSRNVDVSTSPCAAGQTLSAGIFVF*

DNA
ATGATTCTAAGCAAGAGACCTCATCTAATGATCCGTAAACTGTCTGAGATGTTGGTTCCAAGAAGCAGATCTGCTGCCAT
TAAACCGGAGGAGTACACGGCGAGTCCGAGAAGTCCCTTGGATTTGAACTTCCCCTCACCGGTTAACTCGAAGCGGTTCG
GTTCTGGTGGTGTCGGTTTGGGTATCGTTGCTGCGTTGGAGGAAACTAGCAACGGGATTAACCGGCACGATCCGGTTCGC
TACTCCGGGAGGTTCCGGTGTCCCGAGATTGATCTGTCGGATGAGGAGGAATACACTTATGTCACGAGCCCAAACGGACC
GACTAAAGTGTATTACAACGACGACGGGTTTAAATTGTGTGAAAATGATTATCGGAGAGTGCATAAACCGATGGTTATCG
CCGATGAACCACCGGTTATTAAAAGACAGAGTTTTGGGGATCCGACTGAGTTTCTGAGTTCATGTTGCTTGTGTAAGAAG
AAACTTCAAGGCAAAGACATATACATGTACAAAGGAGAGATGGGATTTTGTAGTGCTGAATGCAGATCAGTGCAAATAAT
GAATGACGAACGAAAAGAGCAATGTAAGACGCAAGTTTCAAGGAACGTCGACGTTTCGACCTCTCCTTGCGCCGCCGGAC
AGACGTTATCTGCCGGGATATTCGTATTTTAG