Details for Lyrate rockcress Locus 16036731

Position : sca3 ( 5`- 4344198 .. 4340397 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_317879 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16036731

Protein [Map View]
MTTTRRKSTHWCNTCRRGIHLQGEGRRGGACIYCGNTFLERLYENVELSPFDLFGLAFEEARNRHNNRRSVLGDQLSFEE
LLNRLPAQDRRGPPPASLAAINSLQKIKIKQKHLGLDPYCPVCQDQFEIGSDARKMPCKHIYHSECILPWLVQRNTCPVC
RKELPQDRSNGRKNPLWHLWPFRWGFSLLLWLETLVCFLSMGKTEDDVNLRVAGGEATGDSTERNARCGYCKWISSFVGF
KCFFVLLLSVSLFLSALFLLLPFPMDREDSNLDPRFRGHAILASFSINRSASFLNENTLQLQNDIFQEMSYISIKVTILA
VEPSDELNVTKVVFGIDPDTGYREILPLSLSSIKEMFESVLINQSTLQLTKSLFGETLLFEVLKFPGGITVIPPQSVFPL
QKFKIVFNFTLNYSIHQIQINFNTLASQLKNGLNLAPYENLYVSLSNSEGSTVSPPTTVHSSVLLRVGTSNSSPRLKQLT
DTITGSRSKNLGLNNTIFGKVKQVRLSSFLPNSSDSSTKSPSPSPSPHSKHHHHHHHHHHHHHHHHHHHHNHHHHHHHNL
SPNMAPEVSPVASPAPQRSRRRAPSAPPPCNSGNRVHFKEKHVHFPSTPAPAPSAGAPRHQLHSPAPIPAAKSHIVPISA
PLPHVVFAHAAQPPKTEPRESHANEAAHPQPQSSSSIAVLPALPWIVLLMLIVAGLHE*

DNA
ATGACTACGACTAGGCGAAAAAGCACACATTGGTGTAATACTTGTAGACGAGGAATCCATCTTCAAGGAGAAGGCAGAAG
AGGAGGAGCTTGCATTTATTGTGGTAACACCTTTCTTGAGAGACTCTATGAGAATGTGGAACTAAGCCCTTTTGATTTAT
TCGGATTAGCCTTTGAAGAAGCTCGTAACCGTCACAATAACAGAAGATCGGTTCTCGGAGACCAACTAAGTTTTGAAGAG
TTGTTGAACCGGCTCCCAGCGCAAGATCGTCGTGGTCCTCCTCCAGCTTCACTAGCTGCGATTAACTCATTGCAAAAGAT
CAAAATTAAGCAGAAGCATCTCGGTTTGGATCCATATTGTCCGGTTTGCCAAGACCAGTTTGAAATCGGATCGGATGCAA
GAAAGATGCCGTGTAAACATATCTACCATTCGGAATGTATACTCCCGTGGTTAGTCCAGCGTAATACTTGCCCCGTCTGC
CGCAAAGAACTACCACAAGACCGGAGTAATGGCCGGAAAAATCCATTGTGGCATCTTTGGCCGTTCAGGTGGGGTTTCTC
TTTGTTGCTATGGCTTGAAACCTTAGTTTGCTTTTTGTCAATGGGTAAAACCGAGGATGATGTGAATCTCCGTGTCGCCG
GCGGCGAAGCTACCGGCGATTCGACGGAGAGGAATGCTCGGTGTGGGTATTGCAAATGGATCTCAAGCTTCGTTGGGTTC
AAATGTTTCTTCGTACTGCTTTTATCAGTCTCTTTGTTTCTTTCGGCTTTGTTTTTGTTGCTTCCGTTTCCTATGGATCG
TGAGGATTCGAATCTCGATCCCAGATTTAGAGGTCATGCTATATTAGCCAGTTTTAGCATCAATAGATCGGCTTCTTTTC
TTAATGAAAATACATTGCAGCTTCAGAATGACATCTTTCAAGAGATGAGCTACATTTCCATCAAAGTAACTATCCTGGCT
GTTGAGCCGTCAGATGAATTGAACGTAACAAAGGTTGTGTTTGGAATTGACCCTGATACTGGATACCGAGAAATCTTACC
TCTGTCCTTGAGTTCTATCAAAGAGATGTTCGAATCTGTGCTCATAAATCAATCTACTCTCCAGCTTACAAAATCCTTGT
TTGGGGAAACCTTACTTTTTGAAGTGCTAAAGTTTCCAGGAGGAATCACTGTGATTCCACCGCAAAGTGTTTTCCCTCTG
CAGAAATTCAAGATTGTTTTCAACTTTACCCTAAACTACTCTATTCACCAGATACAGATAAACTTCAATACCCTTGCTAG
TCAACTCAAGAATGGGCTGAATCTCGCACCATACGAGAATTTGTATGTAAGCTTATCGAACTCAGAAGGGTCGACCGTGT
CTCCCCCGACAACTGTTCACTCATCGGTTTTGCTAAGAGTCGGGACTTCAAATTCAAGCCCAAGGTTGAAACAACTGACT
GATACAATCACAGGTTCACGCTCGAAAAACCTTGGCCTGAATAATACCATATTTGGTAAGGTCAAGCAAGTTCGTCTTTC
ATCTTTCTTGCCAAACAGCAGTGATAGTAGCACCAAATCTCCATCACCCTCACCTAGTCCCCACTCCAAGCACCACCATC
ACCATCACCATCACCATCACCACCATCACCACCACCACCATCACCATCACAACCATCATCACCACCACCACCACAATCTT
AGCCCGAATATGGCTCCCGAGGTTTCACCTGTGGCCTCTCCTGCTCCTCAGAGAAGCCGTAGGAGAGCTCCATCTGCACC
TCCACCCTGCAACTCAGGGAATAGAGTACATTTCAAGGAGAAACACGTGCATTTTCCATCCACACCTGCGCCTGCTCCTT
CTGCTGGGGCACCACGTCATCAGCTGCACTCACCGGCCCCGATTCCTGCAGCCAAGTCTCATATAGTTCCAATCTCTGCC
CCTCTACCACATGTGGTGTTTGCCCATGCAGCTCAACCACCCAAAACTGAACCAAGGGAATCACACGCAAACGAAGCTGC
TCATCCTCAACCGCAGTCCTCTTCATCGATTGCGGTTTTACCGGCTCTGCCATGGATTGTCCTTCTCATGCTGATAGTGG
CCGGGCTTCATGAATAA