Details for Lyrate rockcress Locus 16036729

Position : sca5 ( 5`- 17861835 .. 17860517 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16036729

Protein [Map View]
MPSILRPPRNTICGSCYEGARTTIALLKKLEGSKEDHEKSNHKSTVNNGSSLSSSPLFSCEPQPLEKVIKWMKNMKETEE
EQKKRIVFLSSFVSGFKEQLHADILLKPGDDGPPIPAHRALLASKSEIFKNILDSDGCKTAPEYAITLQELNSEQLQALL
EFLYTGTLASDKLEKHIYALFLAADKYMIHYLQELCEQYMLSSLDISSVLDVLDVSDLGSSTTLKEACLRFVMRNMDDVV
FSDKYEVFSQKNQHLCVEITRAFLMETRSKRRDLSN*

DNA
ATGCCATCTATTTTAAGACCACCTAGGAACACAATATGTGGATCGTGCTACGAAGGGGCTAGAACCACTATCGCCCTGCT
CAAGAAACTTGAGGGCTCGAAAGAAGATCATGAAAAATCGAACCATAAATCCACCGTCAATAATGGCTCCTCTCTTTCTT
CTTCTCCTTTGTTTTCTTGTGAGCCGCAACCATTAGAGAAGGTGATCAAATGGATGAAAAACATGAAAGAAACCGAAGAA
GAACAGAAGAAAAGGATAGTCTTCTTGAGCAGCTTTGTTTCGGGTTTCAAAGAACAGCTTCATGCTGATATTCTTCTAAA
ACCTGGCGACGATGGCCCTCCAATTCCTGCACATAGAGCTTTGCTGGCTTCAAAATCTGAGATCTTCAAGAACATTCTAG
ACTCCGACGGATGCAAAACCGCTCCAGAATACGCGATAACGCTCCAAGAGCTGAATTCTGAGCAACTTCAAGCTCTCTTG
GAGTTTCTATACACCGGCACATTGGCTTCAGACAAGTTGGAGAAACATATTTATGCATTGTTTCTTGCAGCAGATAAGTA
CATGATTCATTACTTGCAAGAGTTGTGCGAGCAATATATGTTGAGTTCCTTAGACATTTCTAGTGTTCTTGACGTTCTTG
ATGTCTCGGATCTTGGTTCAAGCACGACGCTGAAGGAGGCTTGTCTAAGATTCGTGATGCGGAACATGGACGACGTCGTT
TTCTCGGATAAGTACGAAGTGTTCTCTCAGAAAAACCAACATCTATGTGTGGAGATCACAAGGGCGTTCTTGATGGAAAC
GAGAAGCAAGAGACGTGATTTATCAAATTAG