Details for Lyrate rockcress Locus 16036700

Position : sca3 ( 5`- 3459212 .. 3457366 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_478178 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16036700

Protein [Map View]
MVLGCFPLKSKKKRGSVSMKRLDLEESKPTALPEPPKIPSRNLQSAPPSFRTRVKPIQSNNGGTGEMSSRARVMSAPSSI
HGAAERDLLAGVYHDEQDEQPRDPRTSTKESSPQPLPLPSPRTGSSLKNWGSFKSFNGSSGRLSSSAAVSGPLPLPPSGS
VRSFSYDEVMAACNAFSSDRCVVEGLSSVMYMASFGDEASTSGLKKVDATVVRLHVTTQSIREFINEVNTLASLLHQNLC
KLVGYHARDGSDTRMLVYERLALGSLDRLLHGRSDGPPLDWNTRMKIALCAAQGLTFLHEEGPFQAMYNEFSTANIQVDK
DFSAKLSGYGCAGHAPETETSNSSVLANLPVETLERGILTPKSNVWSYGIVLLEMLTGRKNMDGSYPKEERNLVKWSRAF
LADDCRLSLIMDPQLKGRFPAKAARSIADIAQKCLQVEPSERPTMRNIVDQLKIIQDMKYSCRFPLREPAPVAARKHMGR
SSSLNTIIWTPSSVPPRSSFSPSPPPRRPSVSPTRGRALVFPPVFPPRACSSLEEMAREEVRRSSSASGRRTSLEGF*

DNA
ATGGTTTTGGGGTGTTTCCCTTTGAAAAGCAAGAAGAAACGTGGCTCTGTTTCTATGAAACGGTTGGATCTTGAAGAAAG
CAAGCCAACTGCTTTACCTGAGCCACCAAAGATTCCAAGTCGTAATTTACAATCAGCTCCTCCGAGTTTCAGAACTCGTG
TGAAGCCAATTCAATCTAACAACGGTGGAACCGGAGAGATGAGTAGTCGGGCAAGAGTCATGTCTGCTCCGTCAAGCATC
CACGGTGCAGCGGAACGGGATTTGCTTGCTGGTGTTTACCACGACGAGCAAGATGAACAACCAAGAGATCCACGTACTTC
TACTAAAGAGTCTAGCCCTCAACCGCTTCCGTTACCATCACCAAGAACTGGTTCTTCGTTGAAGAATTGGGGGAGCTTTA
AGTCGTTTAACGGAAGCAGCGGTCGGTTATCCTCATCAGCGGCTGTATCTGGACCTTTACCTTTGCCACCTAGCGGGTCA
GTTAGGAGCTTTTCATATGATGAAGTTATGGCTGCCTGTAACGCCTTTTCGTCTGACCGATGCGTCGTGGAGGGTCTTTC
ATCTGTTATGTATATGGCTTCCTTTGGTGATGAGGCTTCGACCTCAGGCTTAAAGAAGGTTGACGCAACTGTTGTGCGAC
TTCACGTAACTACTCAGAGTATCAGGGAGTTCATTAATGAAGTCAACACATTGGCGTCGCTGCTACACCAGAATCTTTGT
AAGCTGGTAGGCTATCATGCCCGTGACGGTTCTGACACAAGAATGTTGGTGTACGAGAGGCTTGCTCTCGGGAGCCTGGA
CCGGTTGCTCCATGGGAGATCAGATGGGCCTCCTCTTGATTGGAACACTAGAATGAAGATTGCGCTATGCGCAGCCCAGG
GCCTAACCTTCTTGCACGAAGAAGGCCCTTTTCAGGCAATGTACAATGAATTTTCGACGGCGAATATCCAAGTCGATAAA
GATTTCAGCGCCAAGCTATCAGGATACGGTTGCGCAGGCCATGCGCCTGAGACAGAGACATCTAATAGTTCAGTACTTGC
GAATCTCCCGGTCGAGACGCTAGAGAGAGGGATTTTGACCCCGAAGAGCAATGTGTGGAGCTATGGAATAGTTCTTCTTG
AGATGTTGACGGGGCGGAAAAACATGGACGGTTCTTACCCGAAAGAAGAGAGGAACTTGGTGAAATGGAGCAGAGCTTTC
CTAGCAGACGATTGCAGGCTCTCGCTTATAATGGATCCTCAGCTTAAAGGTCGGTTTCCAGCAAAAGCGGCAAGGAGCAT
AGCAGATATAGCACAGAAATGTCTGCAGGTGGAGCCATCAGAGCGTCCAACCATGAGAAACATTGTGGATCAACTTAAGA
TCATACAGGACATGAAGTACTCGTGTAGGTTCCCGTTAAGAGAACCCGCGCCAGTCGCGGCAAGGAAACATATGGGAAGA
TCAAGCAGTCTCAACACGATTATTTGGACCCCGTCATCAGTACCACCAAGGTCGAGTTTTTCACCGTCGCCTCCACCACG
ACGACCGTCGGTGTCACCCACAAGGGGACGGGCGCTCGTGTTTCCGCCAGTGTTTCCGCCGCGAGCGTGTTCATCGTTGG
AGGAAATGGCTAGGGAAGAGGTTCGGAGATCGTCTTCAGCCAGTGGTAGGAGAACTAGCCTCGAAGGGTTTTGA