Details for Lyrate rockcress Locus 16036699

Position : sca3 ( 5`- 9186392 .. 9185166 -3` )
Annotation : [B2G] kinase family protein
External links : CoGe
PGDD synteny : 16036699

Protein [Map View]
METLPSSPPSSPPEILDLDSIKALKILGKGATGTVFLAHDVVSTSSSSSPFAVKLVHKSSASSLRRARWEIEVLRRLSID
SNQNPFLPRLLASFESPEYFAWAVPYCSGGDLNVLLHRQNEGVFSSSVIRFYVAEIVCALEHLHTMGIAYRDLKPENILI
QQSGHVTLTDFDLSRSLKKPTRPQFYQPDPELITDRKKSRSFSRLISPAVEKNKTGLKKTRSARVNPINRRKTSFSSGER
SNSFVGTDEYVSPEVIRGDGHDFAVDWWALGVLTYEMMYGETPFKGKSKKETFRNVLMKEPEFAGKPNDLTDLIRRLLVK
DPNRRLGCHRGAAEIKEHAFFRGVRWDLLTEVVRPPFIPLRDDGELTVGGFDIREHFEKLRTTPSSAPPSPLQSPPHVCR
KNDPFIDF*

DNA
ATGGAGACATTACCATCGTCCCCACCATCATCACCGCCGGAGATTCTCGACCTTGACTCTATCAAAGCTCTCAAAATCCT
CGGTAAAGGCGCCACAGGTACCGTCTTCCTCGCACACGACGTCGTTTCAACCTCCTCTTCTTCTTCTCCCTTTGCCGTCA
AGCTCGTCCACAAATCCTCCGCTTCCTCTCTCCGCCGTGCACGCTGGGAAATCGAGGTCCTCCGTCGTCTCTCCATTGAC
TCTAATCAAAACCCTTTTCTCCCTCGTCTCTTAGCTTCTTTCGAGTCACCGGAATACTTCGCTTGGGCCGTCCCTTATTG
TTCCGGTGGTGATCTTAATGTCCTTCTTCACCGTCAAAACGAAGGCGTTTTTAGCTCCTCTGTTATAAGATTCTACGTGG
CTGAGATCGTCTGTGCGCTTGAGCATCTTCATACCATGGGGATCGCTTACAGAGACTTGAAACCCGAAAACATTCTGATT
CAGCAATCCGGTCACGTTACGTTAACCGATTTTGACCTTTCTCGGAGCCTCAAAAAACCCACCCGACCCCAATTCTATCA
ACCCGACCCGGAATTGATAACCGATCGTAAAAAAAGTCGGAGCTTTTCTCGGTTGATCTCGCCGGCGGTGGAGAAAAACA
AAACAGGGTTGAAGAAAACAAGATCCGCAAGGGTTAACCCGATTAATCGCCGGAAAACGAGCTTCTCCTCCGGCGAACGT
TCTAACTCCTTCGTCGGAACGGACGAGTACGTCTCGCCGGAGGTAATTCGCGGCGACGGTCACGACTTCGCTGTAGATTG
GTGGGCTCTCGGCGTTTTGACATATGAGATGATGTACGGAGAAACGCCGTTTAAGGGGAAGAGCAAGAAGGAGACTTTTC
GTAACGTGTTGATGAAGGAACCCGAGTTCGCTGGAAAACCCAACGACCTCACTGATTTGATCCGGCGGTTGCTTGTGAAG
GATCCGAATAGACGGTTAGGTTGCCACCGTGGCGCGGCGGAGATAAAGGAGCACGCTTTTTTCAGGGGTGTGAGGTGGGA
TTTGTTAACGGAGGTGGTACGACCGCCGTTTATTCCGTTAAGAGATGACGGAGAATTAACGGTAGGTGGGTTTGATATAA
GGGAGCATTTTGAGAAACTGAGGACGACTCCATCATCAGCTCCTCCGTCACCGTTACAGTCTCCGCCGCACGTGTGTCGT
AAAAACGATCCGTTTATTGATTTCTAA