Details for Lyrate rockcress Locus 16036690

Position : sca2 ( 5`- 16424539 .. 16427091 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16036690

Protein [Map View]
MIRAKHISNLSSSARSFFLSGTRPSAGDGNSCTCAEDESCVSKRQQIRTEVVQTGKKVSNLAAGLAGNILPVEACKPPVV
PKSVEHFTRPLLLPQHVSSPALPGKTDSAIIKDDVGAPIGDQIFKAGNGIGTVNLLSDVANYKIPLSDGTEVVGLPKSCM
VDPTRPISSVKSSNVKVIRREHLAKVYPRSADRVAINSSPSIKQASFEAHDLLSNTASGKRKSMPQRTYIDSTRYASGGC
DYNVHSSDDRTIISSVEGFGKPSREMMRVTPGTAPTPRQYCNPGYVVENVSGILRRFKWGHAAEEALHNFGFRMDAYQAN
QVLKQMDNYANALGFFYWLKRQPGFKHDGHTYTTMVGNLGRAKQFGAINRLLDEMVKDGCKPNTVTYNRLIHSYGRANYL
NEAMNVFKQMQEAGCEPDRVTYCTLIDIHAKAGFLDIAMDMYQRMQAAGLSPDTFTYSVIINCLGKAGHLPAAHRLFCEM
VGQGCTPNLVTFNIMIALHAKARNYETALKLYRDMQNAGFQPDKVTYSIVMEVLGHCGFLEEAEGVFAEMQRKNWVPDEP
VYGLLVDLWGKAGNVEKAWQWYQEMLHAGLRPNVPTCNSLLSTFLRVHRMSEAYNLLQSMLALGLHPSLQTYTLLLSCCT
DARSNFDMGFCGQLMAVSGHPAHMFLLKMPPAGPDGQKVRDHVSNFLDFMHSEDRESKRGLMDAVVDFLHKSGLKEEAGS
VWEVAAVKNVYPDALREKSCSYWLINLHVMSEGTAVIALSRTLAWFRKQMLVTGDCPSRIDIVTGWGRRSRVTGTSMVRQ
AVEELLNIFNFPFFTENGNSGCFVGCGEPLKKWLLESYVERMHLL*

DNA
ATGATTCGTGCAAAGCACATTAGTAATCTTTCTAGCTCAGCAAGATCCTTTTTTCTTAGTGGAACGAGACCTAGTGCTGG
TGATGGAAATTCTTGTACATGCGCTGAGGATGAAAGTTGCGTCTCAAAACGCCAACAAATTAGGACTGAAGTTGTACAAA
CTGGAAAGAAAGTATCTAATCTAGCAGCTGGACTAGCTGGAAATATATTACCAGTAGAGGCTTGTAAACCGCCGGTGGTC
CCGAAGTCGGTTGAGCATTTCACTCGACCATTGCTTCTTCCGCAGCATGTATCCTCTCCTGCTTTGCCGGGGAAAACAGA
TTCTGCTATTATTAAAGATGATGTGGGGGCACCTATTGGTGATCAGATATTCAAGGCTGGTAATGGTATTGGAACTGTAA
ATTTATTGTCAGATGTAGCAAACTATAAGATCCCTTTATCAGATGGAACTGAAGTTGTCGGTTTGCCTAAAAGCTGTATG
GTTGATCCTACTCGGCCTATTTCGAGTGTAAAGTCTTCAAATGTGAAAGTCATCAGAAGAGAGCACCTTGCTAAAGTCTA
CCCTAGGTCCGCAGACCGCGTTGCTATAAACAGCTCTCCAAGTATTAAGCAAGCGTCATTTGAAGCTCATGATTTACTCT
CAAACACTGCCTCTGGAAAGAGGAAAAGCATGCCACAAAGAACCTATATTGATTCAACCAGGTATGCATCTGGTGGTTGT
GACTATAATGTGCATTCTTCGGATGACAGAACGATAATATCCTCTGTTGAAGGTTTCGGTAAACCCTCAAGGGAAATGAT
GAGAGTGACTCCAGGGACTGCTCCAACACCTAGGCAGTATTGTAACCCTGGATACGTTGTAGAAAATGTTTCTGGTATAT
TGCGGAGATTCAAATGGGGACATGCTGCTGAAGAGGCCCTTCACAATTTCGGTTTCAGGATGGATGCATACCAAGCTAAT
CAAGTTCTTAAGCAGATGGATAATTATGCGAATGCACTTGGTTTCTTTTATTGGCTGAAAAGGCAACCTGGGTTTAAGCA
TGACGGGCATACTTATACCACTATGGTAGGTAATCTTGGTCGTGCAAAGCAATTCGGTGCGATAAACAGGCTTCTTGATG
AGATGGTTAAAGATGGATGTAAGCCAAATACTGTTACATATAACCGGCTCATCCATAGCTACGGCCGTGCAAATTACCTC
AATGAAGCTATGAATGTTTTTAAGCAGATGCAAGAGGCTGGTTGTGAGCCTGACCGTGTAACTTACTGTACCCTGATAGA
CATCCATGCTAAAGCTGGATTTCTTGACATTGCCATGGACATGTACCAAAGAATGCAAGCAGCAGGGCTTTCTCCTGATA
CTTTCACCTACAGTGTTATAATAAATTGTCTTGGAAAAGCGGGCCACTTACCTGCTGCACATAGGCTCTTTTGTGAAATG
GTAGGTCAAGGTTGTACCCCTAATTTGGTCACATTCAACATCATGATAGCTTTGCATGCCAAGGCGCGGAATTATGAGAC
TGCGTTGAAGCTCTACAGAGACATGCAAAATGCCGGGTTTCAACCGGACAAAGTGACATACAGTATTGTTATGGAGGTAC
TTGGACACTGTGGATTTCTCGAGGAAGCAGAGGGTGTTTTCGCTGAGATGCAACGTAAGAACTGGGTTCCTGATGAACCG
GTTTACGGTCTTTTGGTGGACTTGTGGGGAAAAGCTGGCAATGTGGAAAAAGCTTGGCAGTGGTATCAAGAAATGCTTCA
CGCCGGTCTGCGACCTAATGTTCCCACATGCAATTCCCTTCTCAGCACTTTCCTTAGGGTTCACAGGATGTCTGAAGCCT
ATAACTTATTACAAAGCATGCTGGCGCTTGGTCTACATCCTTCTTTGCAGACATACACATTGCTATTGAGTTGTTGCACA
GATGCTCGTTCAAACTTTGACATGGGCTTTTGTGGCCAGCTAATGGCAGTCTCAGGTCATCCGGCTCACATGTTTCTCCT
CAAAATGCCACCTGCAGGTCCTGATGGCCAAAAAGTGCGTGATCATGTCAGCAACTTCCTTGATTTTATGCACAGTGAGG
ACAGAGAGAGCAAGCGAGGACTCATGGACGCAGTAGTGGATTTTCTCCACAAGTCAGGTCTAAAAGAAGAGGCTGGTTCG
GTATGGGAAGTGGCTGCAGTTAAGAATGTGTATCCAGATGCATTGAGGGAGAAAAGCTGCAGCTATTGGCTTATAAATCT
CCATGTAATGTCGGAAGGAACTGCAGTCATCGCACTTTCTAGGACACTTGCATGGTTCCGTAAGCAGATGTTGGTTACAG
GAGACTGTCCTTCACGGATTGATATAGTAACTGGTTGGGGAAGACGAAGTAGAGTCACAGGCACGTCGATGGTTAGACAA
GCAGTTGAGGAATTGCTCAACATATTCAACTTCCCGTTTTTCACTGAGAACGGGAACTCGGGCTGTTTTGTAGGATGCGG
AGAGCCTCTCAAGAAGTGGTTGCTTGAATCATATGTTGAGAGGATGCATTTGCTTTAG