Details for Lyrate rockcress Locus 16036677

Position : sca3 ( 5`- 4619534 .. 4617985 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16036677

Protein [Map View]
MAMTIEVLAGLAFMFSSSILLQILACAIYGNWWPMLSALMYVVVPMPCMFFGGGSTQFLTSRDGGGWIDAAKFLTGASTV
GSLAIPIILRHAQMIETGAMLIEFTSFFIFICTVMCFHRASLDDDW*

DNA
ATGGCGATGACCATCGAAGTACTTGCTGGACTTGCTTTCATGTTTTCATCTAGTATCCTCCTACAGATCCTGGCATGTGC
GATATATGGTAATTGGTGGCCAATGCTATCAGCACTCATGTATGTAGTGGTGCCTATGCCTTGTATGTTCTTTGGAGGAG
GCTCAACTCAATTCCTTACTAGTCGGGACGGTGGAGGGTGGATAGATGCAGCTAAGTTCTTGACCGGAGCGTCGACCGTG
GGAAGCCTCGCTATCCCAATCATCCTAAGGCATGCACAGATGATCGAGACAGGTGCAATGCTCATAGAATTCACATCGTT
CTTCATTTTCATCTGCACTGTCATGTGTTTCCACCGGGCTAGTCTCGATGATGACTGGTAA