Details for Lyrate rockcress Locus 16036658

Position : sca3 ( 5`- 12398137 .. 12399447 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16036658

Protein [Map View]
MARSNVPKFGNWEAEENVPYTAYFDKARKTRAPGGKIINPNDPEYNSDSQSQAPPPPSRTKAEQVEPVRRSREHMRSREE
SELKQFGDAGGSSNEAANKRQGRASQNNSYDKSPLHKNSYDGTGKSRPKPANLRADESPEKVTVVPKFGDWDENNPSSAD
GYTHIFNKVREERSSGANVSGSSRTPTHPNSSKPNNTSTCCCFGFGGK*

DNA
ATGGCACGTTCGAATGTACCCAAATTTGGAAACTGGGAAGCTGAGGAGAATGTTCCTTACACAGCTTACTTTGACAAAGC
TCGTAAGACTCGAGCACCCGGTGGCAAGATCATTAACCCGAATGACCCGGAGTATAACTCTGATTCTCAATCACAAGCTC
CTCCTCCTCCTTCCAGAACCAAAGCTGAGCAAGTTGAGCCGGTTAGAAGATCGCGTGAGCATATGAGAAGCCGAGAAGAG
AGCGAGTTGAAGCAGTTTGGTGATGCTGGTGGTTCATCAAATGAAGCTGCTAACAAAAGACAAGGAAGAGCTTCTCAGAA
CAATAGTTATGACAAGTCACCTTTGCATAAGAATTCATATGATGGTACTGGAAAATCTAGGCCTAAACCTGCTAATCTTA
GAGCTGATGAAAGCCCTGAAAAAGTCACAGTGGTGCCGAAGTTCGGTGACTGGGACGAGAACAACCCGTCATCAGCTGAT
GGATACACACATATCTTCAATAAAGTCCGCGAAGAGAGAAGTTCTGGAGCAAATGTGAGTGGATCTTCAAGAACGCCAAC
TCATCCAAACTCCAGTAAACCTAACAATACTTCCACATGTTGCTGCTTTGGTTTTGGAGGAAAATGA