Details for Lyrate rockcress Locus 16036654

Position : sca3 ( 5`- 9240769 .. 9242797 -3` )
Annotation : [B2G] rna recognition motif-containing protein
External links : CoGe
PGDD synteny : 16036654

Protein [Map View]
MEALIAPTSFFLPISNSSSHIINNRFFPSFSSPNLNLGTFRKTYTSLSSSHIVYSSSAISAPPSSTASPTRNSYWMVLLD
KPPQWVSSKSDIVDYYVEILAKVLGNEKDAQVSIYDASFDTHFGFCCYIDEDASRQLACLPGVVSVRPEAGYSSEKKNYG
FGNQTCVSLFDHGTVKHWMVRIDKPGVGIVTKAQMVDHCVQLLSKVLCNEKDAQMCLYHVSWQSDFGFCCDLDENSAVEL
AGVPGVLAVVPDNSFESLNKDYEGDSTQASRDQDDSESPPIKTKKLFITGLSFYTSEKTLRAAFEGFGELVEVKIIMDKI
SKRSKGYAFLEYTTEEAASAALKEMNGKIINGWMIVVDVAKTKPFRQNRSQPSSGF*

DNA
ATGGAAGCTCTTATTGCTCCCACTTCCTTCTTCCTCCCCATCTCCAACTCTTCCTCACACATTATCAATAACAGATTCTT
CCCTTCATTTTCTTCTCCCAACTTAAATTTGGGGACTTTTCGGAAAACTTATACCTCCTTGTCATCATCACACATCGTCT
ACTCCTCTTCTGCAATTTCCGCACCGCCTTCTTCTACTGCTTCTCCTACCCGAAACAGCTATTGGATGGTGTTATTGGAT
AAACCTCCGCAATGGGTTTCTTCCAAATCAGACATCGTTGATTATTATGTCGAGATTCTTGCGAAAGTACTGGGAAACGA
AAAAGATGCCCAAGTGAGTATATATGATGCTTCCTTTGATACCCATTTCGGGTTTTGTTGTTATATCGACGAAGATGCTT
CACGCCAGCTCGCTTGTTTACCTGGAGTAGTGTCTGTTAGACCTGAAGCGGGTTACAGTTCAGAGAAGAAGAATTATGGT
TTTGGGAATCAGACATGTGTTTCATTGTTTGATCATGGGACAGTGAAACATTGGATGGTTCGAATAGATAAGCCAGGAGT
TGGGATTGTTACTAAAGCACAGATGGTTGATCATTGTGTTCAATTGCTATCCAAGGTTTTGTGCAATGAAAAGGATGCAC
AGATGTGTCTTTATCATGTTTCCTGGCAGTCTGATTTCGGATTTTGTTGTGATCTCGATGAGAATAGTGCCGTGGAGTTA
GCTGGCGTACCTGGTGTTCTTGCGGTTGTTCCTGATAACAGTTTCGAGTCACTAAACAAAGACTATGAAGGGGATAGTAC
ACAAGCTTCACGAGATCAAGATGATTCAGAGTCTCCTCCCATAAAGACGAAGAAGCTGTTTATAACTGGACTGTCTTTCT
ACACATCTGAGAAGACATTACGTGCAGCATTTGAAGGGTTTGGTGAACTAGTGGAAGTCAAAATAATTATGGACAAGATA
TCAAAGAGATCAAAAGGCTATGCCTTTCTAGAGTACACGACAGAGGAAGCCGCAAGCGCTGCACTAAAAGAGATGAATGG
AAAGATTATTAATGGGTGGATGATAGTAGTAGATGTAGCCAAGACCAAACCATTCAGGCAAAACAGAAGTCAACCGAGTT
CGGGGTTCTAG