Details for Lyrate rockcress Locus 16036646

Position : sca3 ( 5`- 4966517 .. 4961265 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_318010 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16036646

Protein [Map View]
MAITPLRITNPFPSLRFIPAGKSNAPRLLTFRATDVESTEETQPDPETTTQSESGTDPDQFESRLSNIRLRYRSGTGKKA
EVRKSKKGSSGSPSKGSGMYLPPVSLKEAVSGGLKVELGFSSYSERINGRIAGLGLMALLLVELATGKSVLNYHTPSVVF
LQIYFVAAVSAMFVKIEKEKATLGHGTATIKSILQCNVGNKSPLLLCVLSPDKVDSCQLNLEFEETDEVIFSVIGPRSVH
LTGYFLGRSTAFRPNDDESESYGEDIVDTDMEKGSSDDYDYSDSFINDDDPPGRGSHLSSTDDDEISIKEMAAKTKDKIK
NGKGGRLRKKFQVPDSDSDETSARAGESSNEDSVEILNNGNEHKIAKVLSSESPLPSRVTRSKARSSTLENGEPNAKCEK
TSDGRTHTHKTLDKRQDKSLGDVKLSPVQKGCEILSKKKRNKDRSKSSAIIINSDDKEGKNIPGNLQNEKPVTDEGIKSS
SDVLLSQNGDATLSKKKRKRDRREETTDVPENLVECPEKKKQAIDMNIEKEAGTKKPLETRTLSNGVIIEEIEKGKLDGK
SAVKGKKVSILYTGKLKDTGELFDSNLGEAPLRFRLGGENVIEGLSIGAEGMRVGDKRRLIIPPSLGYSKKGLKEKVPKN
AWLVYEVEAVKVR*

DNA
ATGGCGATAACACCTCTACGAATCACCAACCCATTCCCATCTCTGCGTTTTATTCCCGCCGGGAAATCCAATGCTCCGAG
ACTCCTTACCTTCCGCGCCACCGACGTTGAGTCCACGGAGGAGACTCAACCCGACCCGGAAACAACAACCCAGTCAGAAT
CCGGCACTGATCCGGACCAATTCGAGTCTCGTCTCTCAAACATCAGACTCAGATACCGAAGCGGGACGGGTAAGAAAGCA
GAAGTGAGAAAATCGAAGAAAGGGTCAAGTGGGTCTCCGTCAAAAGGCTCGGGAATGTATTTGCCGCCGGTAAGCTTGAA
AGAGGCGGTTTCAGGTGGTTTGAAAGTGGAATTAGGGTTTAGCTCGTACAGTGAAAGGATCAACGGGAGGATTGCGGGAT
TAGGGCTCATGGCTTTGCTTCTTGTTGAGCTTGCGACGGGTAAGAGTGTGTTGAATTACCACACGCCTTCTGTGGTGTTT
CTTCAGATCTATTTTGTTGCGGCTGTTTCTGCTATGTTTGTCAAGATTGAGAAGGAAAAGGCCACATTGGGCCATGGTAC
TGCAACCATTAAAAGCATTCTACAGTGTAACGTTGGGAACAAAAGTCCCCTCTTGTTATGTGTCTTGTCTCCCGACAAGG
TTGATTCTTGCCAACTGAATCTGGAGTTTGAAGAAACTGATGAAGTTATCTTCTCTGTCATCGGACCTCGGAGTGTTCAC
CTCACTGGCTACTTCCTCGGAAGGAGTACCGCTTTTAGGCCAAATGATGATGAATCAGAGTCATATGGAGAAGACATTGT
TGACACAGACATGGAGAAAGGTAGCAGTGATGATTATGACTACAGTGATAGTTTCATTAATGACGACGATCCTCCTGGCC
GTGGTTCACACTTGTCTAGTACTGATGATGATGAAATATCTATTAAGGAGATGGCAGCTAAAACAAAAGACAAGATAAAA
AATGGAAAAGGTGGAAGGCTAAGGAAGAAGTTTCAAGTCCCTGATTCAGATTCTGATGAAACGTCAGCTAGAGCTGGTGA
ATCTAGCAATGAGGATTCTGTAGAAATACTTAACAATGGTAATGAGCACAAGATCGCCAAGGTCCTTTCTTCAGAGAGTC
CTTTACCTTCGAGGGTTACGAGGTCGAAGGCAAGAAGTTCGACTTTGGAAAATGGTGAGCCTAATGCCAAGTGTGAGAAG
ACATCAGATGGAAGAACTCATACTCACAAGACTCTGGATAAAAGGCAAGATAAATCATTGGGTGATGTTAAACTTTCTCC
CGTCCAGAAAGGCTGTGAAATTCTTTCGAAGAAAAAAAGAAACAAGGATAGGTCTAAGAGCTCAGCTATAATCATTAACT
CAGATGACAAAGAGGGGAAAAATATACCTGGAAATCTTCAGAATGAGAAGCCAGTTACTGATGAGGGGATCAAATCATCA
AGTGATGTATTACTTTCTCAGAATGGTGATGCAACTCTATCAAAGAAAAAGAGGAAAAGGGATAGGAGAGAGGAAACTAC
AGATGTCCCAGAAAATCTAGTTGAATGTCCAGAGAAGAAGAAACAAGCTATCGACATGAACATCGAGAAAGAAGCTGGTA
CTAAGAAACCACTAGAAACGAGGACTTTATCAAATGGAGTGATCATTGAAGAGATTGAAAAAGGAAAGTTAGATGGAAAA
TCAGCTGTTAAAGGGAAAAAGGTCAGTATACTCTATACTGGGAAGTTGAAGGACACCGGGGAATTGTTTGATTCAAACTT
GGGAGAAGCTCCACTAAGATTCCGCTTAGGTGGAGAAAATGTCATAGAAGGTCTCAGCATTGGTGCTGAAGGAATGCGAG
TTGGTGATAAGAGAAGACTCATAATTCCGCCATCCCTCGGGTACTCAAAAAAGGGATTGAAGGAAAAGGTGCCTAAGAAT
GCGTGGCTTGTCTATGAAGTGGAGGCAGTAAAAGTTAGATAA