Details for Lyrate rockcress Locus 16036627

Position : sca3 ( 5`- 3138606 .. 3138902 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16036627

Protein [Map View]
MVRRNTVHAISSLPSRYLWPQQRRKGKRVVVRLGNRRRGFFVGPPRMVVQRWRMNIGKPMKMMRSIILGILSNGGNVKFL
DAYLWSLPILRPQLFPLC*

DNA
ATGGTAAGAAGAAACACAGTTCATGCCATTTCAAGTCTTCCGTCGAGGTACTTGTGGCCGCAGCAACGAAGGAAAGGAAA
ACGAGTCGTCGTGCGGTTAGGTAACCGGCGACGAGGGTTCTTTGTGGGGCCACCGCGGATGGTGGTGCAGAGATGGAGGA
TGAACATCGGAAAGCCGATGAAGATGATGAGAAGTATCATTTTGGGGATACTCTCAAATGGTGGAAATGTTAAGTTCTTA
GATGCTTATCTTTGGTCTTTACCAATCTTACGTCCTCAGTTGTTTCCGCTATGTTGA