Details for Lyrate rockcress Locus 16036617

Position : sca3 ( 5`- 6753932 .. 6756447 -3` )
Annotation : [B2G] zinc finger family protein
External links : CoGe
PGDD synteny : 16036617

Protein [Map View]
MIRLRTYAGLSFIATLAVIYHAFSSRGQFYPATVYLSTSKISLVLLLNMCLVLMLSLWHLVKFVFLGSLREAEVERLNEQ
AWRELMEILFAITIFRQDFSSGFLPLVVTLLLIKALHWLAQKRVEYIETTPSVSKLSHFRIVSFMGFLLLVDSLFMYSSI
RHLIQSRQASVSLFFSFEYMILATTTVAIFVKYVFYVTDMLMDGQWEKKPVYTFYLELIRDLLHLSMYICFFFVIFMNYG
VPLHLLRELYETFRNFQIRVSDYLRYRKITSNMNDRFPDATPEELTASDATCIICREEMTNAKKLICGHLFHVHCLRSWL
ERQQTCPTCRALVVPPENATSAAAGQRGLHQGSQQGTSSSNNQGSEASSAAGVSNDNLSRHHARLQAAASAASMYGKSMV
YPSANTVAWSPSIPGTEQVSTEPHQTRPSSFSSSQLPQDNLPGENPQAYANMSETKLEEMRKSLEAHLEILRNRLHYLEK
RKPESTGEADNKGKSVADAAGE*

DNA
ATGATTCGACTAAGAACATACGCAGGCCTTAGTTTTATAGCAACTTTGGCTGTAATCTATCATGCATTCAGCAGCAGAGG
CCAATTTTACCCTGCGACTGTTTATTTATCAACCTCAAAGATCAGTTTGGTGCTGCTTCTCAATATGTGTTTGGTTCTTA
TGCTTAGTCTCTGGCATTTGGTCAAATTTGTCTTCTTGGGGTCTCTTAGGGAAGCAGAAGTCGAGAGGTTGAATGAACAA
GCTTGGAGAGAACTCATGGAGATTCTCTTTGCCATTACTATCTTTAGACAGGATTTCTCTAGTGGGTTTCTTCCTTTGGT
TGTTACTCTTCTGTTGATCAAGGCTTTGCATTGGCTTGCTCAGAAAAGAGTTGAATACATTGAGACTACTCCTTCTGTGT
CTAAGCTTTCTCATTTTCGTATTGTCTCTTTTATGGGTTTCCTTCTTCTTGTGGATAGTTTGTTTATGTACAGTTCTATA
CGTCACTTGATTCAGTCGCGCCAGGCTTCGGTTTCTCTCTTCTTCTCATTCGAGTATATGATACTGGCGACGACGACTGT
TGCTATCTTTGTGAAGTACGTTTTCTATGTCACTGATATGTTAATGGATGGTCAATGGGAGAAGAAACCAGTTTATACTT
TCTATCTGGAGCTTATCCGTGACCTGCTTCACTTGTCCATGTATATCTGCTTCTTCTTTGTCATATTCATGAACTATGGT
GTGCCTTTACACTTGTTACGGGAGCTCTACGAGACCTTCAGGAACTTCCAAATTCGTGTTTCCGATTACCTTCGTTATCG
TAAGATCACGTCCAATATGAACGATAGGTTTCCTGATGCAACTCCCGAAGAACTTACCGCAAGTGATGCCACATGTATCA
TATGCCGTGAAGAGATGACAAATGCGAAGAAACTAATATGCGGGCATCTCTTTCATGTGCATTGTCTTCGATCATGGTTG
GAGCGACAGCAGACGTGTCCTACTTGTAGAGCACTTGTTGTACCTCCTGAGAATGCCACATCTGCAGCTGCAGGCCAACG
TGGATTACACCAAGGTTCCCAACAGGGTACATCAAGCTCAAATAACCAGGGCTCTGAAGCAAGTTCTGCTGCTGGCGTTT
CCAATGATAATTTGAGCAGGCACCACGCCAGGCTTCAAGCAGCTGCTTCTGCAGCCTCCATGTATGGGAAATCAATGGTT
TACCCATCTGCAAACACAGTAGCATGGTCGCCGAGTATTCCTGGGACAGAGCAAGTGTCAACTGAACCACATCAAACTCG
TCCTTCATCCTTTTCCTCGTCTCAGCTTCCTCAAGACAACCTTCCAGGTGAAAACCCTCAAGCCTATGCAAATATGTCGG
AGACTAAGCTGGAAGAAATGAGAAAATCTCTCGAGGCCCACTTGGAGATTTTGCGAAACCGGCTTCATTATCTGGAGAAG
AGGAAACCAGAGTCCACAGGAGAAGCAGATAACAAAGGAAAGTCGGTTGCGGATGCAGCAGGGGAGTGA