Details for Lyrate rockcress Locus 16036607

Position : sca3 ( 5`- 10600070 .. 10601067 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16036607

Protein [Map View]
MIDIPGTPGTLTGLVLRISQCVFAAGSISYMVTSGGFFSFTAFCYLIAAMGLQVIWSFGLAILDTFALVRKKTLLSPVLV
SLFVVGDWVTSTLSLAGASSSAGITVLYFGDLGSCSFEAECWKYQLSVALAFLCWITIAISSLTTLWLLASA*

DNA
ATGATAGATATCCCTGGAACACCAGGGACTTTGACTGGTCTTGTCTTAAGAATTTCTCAGTGTGTTTTTGCTGCTGGTTC
GATTTCGTATATGGTTACTTCTGGTGGATTCTTCAGCTTCACTGCTTTCTGCTATCTAATTGCAGCAATGGGTTTGCAAG
TCATATGGAGTTTCGGTCTTGCGATACTAGACACATTCGCCTTAGTGAGAAAGAAAACGCTTCTTAGTCCGGTTTTAGTC
AGCCTATTTGTAGTTGGAGATTGGGTAACATCGACATTGTCACTAGCAGGAGCATCATCATCCGCGGGAATAACGGTTTT
ATACTTTGGCGATTTAGGAAGCTGCAGTTTTGAAGCAGAGTGTTGGAAATACCAACTCTCTGTAGCTTTAGCTTTCCTTT
GTTGGATCACAATCGCCATTTCTTCGCTTACTACACTCTGGTTACTTGCTTCCGCGTAA