Details for Lyrate rockcress Locus 16036596

Position : sca3 ( 5`- 6658552 .. 6656928 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16036596

Protein [Map View]
MAAAANTAAIFASPSQPLSSKRSFLYSSTIGPILRRFPRKKLVLQVKAVATTLAPLEEIKEYKLPSWAMFEMGTAPVYWK
TMNGLPPTAGEKLKLFYNPAASKLTLNDDYGVAFNGGFNQPIMCGGEPRAMLKKDRGKADSPIYTMQICIPKHAVNLIFS
FTNGVDWDGPYKLQFQVPKRWQNKPIEFFNVGLANELSQDGACERAIFPDSNVVATRCTMIANLTVEGGDRCNLDLVPGC
MDTNSEHFNPYANVDDGSCPLELSDSDE*

DNA
ATGGCTGCTGCCGCTAATACCGCCGCCATTTTCGCTTCTCCTTCCCAGCCTTTATCCTCTAAACGCAGTTTTTTGTACAG
TTCAACGATTGGTCCAATACTTAGGAGATTTCCAAGGAAGAAACTTGTTCTCCAAGTTAAAGCTGTTGCCACAACTCTTG
CACCCCTCGAAGAGATCAAAGAATATAAGCTCCCTTCATGGGCAATGTTTGAGATGGGGACTGCTCCAGTGTACTGGAAA
ACCATGAATGGTCTTCCTCCAACCGCAGGTGAAAAGTTGAAACTTTTCTATAATCCAGCTGCAAGCAAACTCACTCTTAA
CGACGACTATGGGGTTGCTTTCAACGGAGGGTTTAACCAACCAATCATGTGTGGTGGGGAGCCAAGAGCAATGCTTAAAA
AAGATCGAGGCAAAGCTGATTCTCCGATTTACACTATGCAGATTTGCATTCCTAAGCATGCTGTGAATTTGATATTCTCA
TTCACCAACGGTGTCGATTGGGACGGTCCATACAAACTTCAGTTTCAAGTCCCCAAGCGATGGCAAAACAAACCTATTGA
GTTCTTCAATGTGGGTCTAGCGAACGAGTTGAGCCAAGATGGAGCCTGCGAAAGAGCAATATTTCCTGACTCGAACGTTG
TTGCAACTCGTTGCACAATGATCGCCAACTTGACGGTCGAAGGAGGAGATAGATGCAATTTGGATCTAGTTCCTGGGTGC
ATGGATACAAATTCAGAACATTTCAACCCATATGCTAATGTTGATGATGGCTCTTGTCCCCTCGAGTTATCCGATTCTGA
TGAATAG