Details for Lyrate rockcress Locus 16036566

Position : sca3 ( 5`- 3395543 .. 3394229 -3` )
Annotation : [B2G] adenosine nucleotide translocator
External links : CoGe
PGDD synteny : 16036566

Protein [Map View]
MVDQVQHPTIAQKAAGQFMRSSVSKDVHVGYQRPSMYQRHATYGNYSNAAFQFPPTSSRMLATTASPVFVQTPGEKGFTN
FALDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIGDCFGRTIKDEGFGSLWRGNTANVIRYFPTQA
LNFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDAKAAKKGGGGRQFDGLVDVYRKT
LKTDGIAGLYRGFNISCVGIIVYRGLYFGLYDSVKPVLLTGDLQDSFFASFALGWVITNGAGLASYPIDTVRRRMMMTSG
EAVKYKSSLDAFTQILKNEGAKSLFKGAGANILRAVAGAGVLSGYDKLQLIVFGKKYGSGGA*

DNA
ATGGTTGATCAAGTTCAGCACCCCACTATTGCGCAGAAAGCTGCTGGACAGTTCATGCGTTCAAGTGTTTCCAAGGACGT
CCATGTGGGTTACCAGAGGCCTTCTATGTACCAGAGACATGCAACCTATGGAAACTACTCCAATGCTGCATTTCAATTTC
CTCCCACATCATCCCGGATGCTGGCAACCACTGCTTCTCCCGTGTTTGTTCAAACTCCAGGAGAGAAAGGGTTCACTAAC
TTTGCCCTTGACTTTCTGATGGGTGGTGTTTCTGCTGCCGTCTCAAAGACTGCTGCTGCTCCTATTGAGCGTGTTAAGCT
TTTGATCCAGAACCAGGATGAGATGATTAAAGCTGGTAGGCTTTCTGAACCCTACAAGGGTATTGGTGACTGTTTCGGCA
GGACGATAAAGGATGAAGGATTTGGTTCTCTATGGAGAGGAAACACTGCCAATGTTATCCGTTACTTCCCCACTCAGGCC
TTGAACTTTGCCTTCAAAGATTACTTCAAAAGGCTTTTCAACTTTAAGAAGGACAGAGATGGTTACTGGAAGTGGTTTGC
TGGTAACTTGGCATCTGGAGGAGCAGCTGGTGCCTCTTCCCTTCTCTTTGTGTATTCCCTTGACTATGCCCGTACCCGTC
TAGCTAATGATGCCAAGGCTGCAAAGAAAGGAGGTGGTGGCAGACAGTTTGATGGTCTTGTCGATGTCTACAGAAAGACA
CTCAAGACTGATGGTATTGCTGGTCTATACCGTGGATTCAACATCTCCTGTGTTGGTATCATTGTCTACCGTGGTCTGTA
CTTTGGACTCTACGACTCTGTGAAGCCTGTTCTCCTCACTGGAGACTTACAGGACAGTTTCTTCGCTAGTTTCGCTCTTG
GATGGGTTATTACCAATGGTGCGGGTCTTGCATCCTACCCCATTGACACTGTCCGCAGAAGAATGATGATGACGTCTGGT
GAGGCTGTCAAGTACAAGAGTTCCTTGGACGCCTTTACCCAGATCCTCAAGAATGAAGGAGCCAAGTCACTCTTCAAGGG
AGCTGGTGCCAACATTCTGCGTGCAGTTGCAGGTGCTGGTGTGCTTTCCGGTTACGACAAATTGCAGCTGATTGTCTTCG
GTAAGAAGTACGGATCAGGAGGTGCTTAA