Details for Lyrate rockcress Locus 16036544

Position : sca3 ( 5`- 8862584 .. 8858886 -3` )
Annotation : [B2G] calcium-binding ef hand family protein
External links : CoGe
PGDD synteny : 16036544

Protein [Map View]
MEIESVAAGSCSKENQLIYKEWFEFADSDGDGRITGNDAIKFFTMSNLPRPELKQIWAIADSKRQGYLAFKDFIVAMQLV
SLAQTGHEISHEILNSDVDFKNINPPTMEGLGVLMAKKKHSSKSSDPNMNGSPAADTSLTAHWFSSKSSKKISLSSVTSI
VDGLKRLYIQKLKPLEVAYRFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLKSSYPGNMQTGAHIGPEPTTDR
FVVVMSGPDERSIPGNTVAVQADMPFSGLTTFGTAFLSKFECSQMPHPLLEHVTFVDTPGVLSGEKQRTQRAYDFTGVTS
WFASKCDLILLLFDPHKLDVSDEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVSRVYIGS
FSDKPINEAATGPIGRELFEKEQDDLLADLKDIPKKACDRRINEFVKRARAAKIHAYIISHLKKEMPAIMGKAKAQQKLI
DNLEDEFGKVQREHHLPKGDFPNVDHFREVLSGYNIDKFEKLKPKMLQTVDDMLGYDIPELLKNFRNPYD*

DNA
ATGGAGATCGAATCCGTCGCAGCTGGTTCTTGTTCAAAGGAGAATCAATTGATCTACAAGGAATGGTTCGAATTCGCCGA
TTCAGACGGCGATGGCCGTATTACTGGTAACGATGCGATCAAGTTCTTCACTATGTCGAATTTGCCTCGACCGGAGTTGA
AGCAGATCTGGGCAATTGCAGATTCAAAGAGACAAGGGTATCTTGCTTTCAAAGACTTTATTGTTGCCATGCAGCTTGTT
TCGTTGGCTCAAACTGGACATGAAATATCGCATGAAATTCTTAATAGCGATGTTGATTTCAAAAATATCAATCCTCCTAC
CATGGAAGGTCTGGGTGTATTAATGGCGAAGAAGAAGCATTCATCAAAGTCGAGTGATCCTAATATGAATGGTAGCCCTG
CCGCAGACACATCACTTACAGCTCACTGGTTCTCTTCAAAATCTTCAAAAAAGATTTCTCTGTCCTCCGTAACATCTATA
GTGGATGGCCTGAAGAGGTTGTACATTCAGAAGCTGAAGCCACTTGAAGTAGCATATCGGTTTAACGATTTTGTATCCCC
TTTGTTGACTAACAGTGATTTCGATGCGAAACCTATGGTAATGCTTCTGGGTCAATACTCCACAGGGAAAACAACATTCA
TTAAGCATTTGCTTAAATCTAGTTATCCAGGCAATATGCAAACAGGAGCTCATATTGGACCAGAGCCGACTACTGACAGA
TTTGTTGTTGTCATGTCTGGACCTGATGAAAGAAGTATTCCGGGGAACACAGTAGCAGTTCAAGCAGATATGCCATTCAG
TGGTCTTACAACTTTTGGGACTGCCTTTTTGTCAAAGTTTGAATGCTCTCAGATGCCTCACCCTCTGCTGGAGCATGTAA
CATTTGTCGACACCCCTGGAGTTTTATCAGGGGAAAAGCAAAGAACCCAGCGAGCATATGATTTCACTGGTGTTACATCA
TGGTTTGCCTCTAAGTGCGATCTTATCCTCCTCTTATTTGACCCACACAAGCTGGATGTAAGTGATGAGTTCAAGCGTGT
AATTTCATCTTTACGCGGTCATGATGACAAGATCCGCGTTGTTCTTAATAAGGCTGATCAAGTGGACACTCAGCAGCTAA
TGAGGGTATATGGAGCTCTCATGTGGTCACTTGGGAAAGTTCTCAATACTCCTGAGGTCTCCCGTGTCTACATTGGTTCG
TTTAGTGATAAACCCATAAACGAAGCTGCAACTGGTCCAATTGGGAGAGAGTTGTTTGAAAAGGAGCAAGATGACCTTCT
TGCTGATTTGAAAGACATTCCAAAGAAAGCTTGTGATCGCCGAATAAATGAGTTTGTGAAACGGGCAAGAGCAGCAAAGA
TACATGCGTACATCATCAGCCATTTGAAGAAGGAGATGCCAGCGATAATGGGGAAAGCCAAAGCTCAACAGAAACTGATA
GATAACTTGGAAGACGAGTTTGGAAAGGTACAAAGAGAGCATCACTTACCAAAAGGAGATTTCCCAAATGTGGATCATTT
CAGGGAGGTGCTAAGTGGTTACAACATCGACAAGTTTGAGAAGCTAAAGCCGAAAATGTTGCAGACTGTTGATGATATGT
TGGGGTATGACATTCCAGAGCTCTTGAAAAATTTCAGAAACCCTTATGATTAA